BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P05_F_B01 (668 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-h... 24 5.0 AY334000-1|AAR01125.1| 268|Anopheles gambiae FBN23 protein. 23 8.7 AY333999-1|AAR01124.1| 268|Anopheles gambiae FBN23 protein. 23 8.7 AY333998-1|AAR01123.1| 268|Anopheles gambiae FBN23 protein. 23 8.7 AY333997-1|AAR01122.1| 268|Anopheles gambiae FBN23 protein. 23 8.7 >AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-helix transcriptionfactor ASH protein. Length = 371 Score = 23.8 bits (49), Expect = 5.0 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +3 Query: 189 GLATDAADPYLATWLQYRAHGKKHNDAQSHQR 284 G ATD + LA Q + H +H Q HQ+ Sbjct: 293 GSATDNNNYILAQQQQQQHHHHQHQPQQQHQQ 324 >AY334000-1|AAR01125.1| 268|Anopheles gambiae FBN23 protein. Length = 268 Score = 23.0 bits (47), Expect = 8.7 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -3 Query: 363 PRVNTKPTLPLMCGNSFXEGWIVVQVVFDG 274 P + +P L SF GW+V Q F+G Sbjct: 155 PTEHDEPFLGYCEQTSFGGGWLVFQYRFNG 184 >AY333999-1|AAR01124.1| 268|Anopheles gambiae FBN23 protein. Length = 268 Score = 23.0 bits (47), Expect = 8.7 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -3 Query: 363 PRVNTKPTLPLMCGNSFXEGWIVVQVVFDG 274 P + +P L SF GW+V Q F+G Sbjct: 155 PTEHDEPFLGYCEQTSFGGGWLVFQYRFNG 184 >AY333998-1|AAR01123.1| 268|Anopheles gambiae FBN23 protein. Length = 268 Score = 23.0 bits (47), Expect = 8.7 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -3 Query: 363 PRVNTKPTLPLMCGNSFXEGWIVVQVVFDG 274 P + +P L SF GW+V Q F+G Sbjct: 155 PTEHDEPFLGYCEQTSFGGGWLVFQYRFNG 184 >AY333997-1|AAR01122.1| 268|Anopheles gambiae FBN23 protein. Length = 268 Score = 23.0 bits (47), Expect = 8.7 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -3 Query: 363 PRVNTKPTLPLMCGNSFXEGWIVVQVVFDG 274 P + +P L SF GW+V Q F+G Sbjct: 155 PTEHDEPFLGYCEQTSFGGGWLVFQYRFNG 184 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 733,741 Number of Sequences: 2352 Number of extensions: 13810 Number of successful extensions: 38 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66904800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -