BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P05_F_A23 (653 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29492| Best HMM Match : Ribosomal_S3_C (HMM E-Value=1.8e-28) 336 1e-92 SB_57373| Best HMM Match : DUF292 (HMM E-Value=4.7) 29 3.3 SB_28852| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_3270| Best HMM Match : MMPL (HMM E-Value=0.68) 29 3.3 SB_51602| Best HMM Match : Glyco_hydro_38C (HMM E-Value=1.1e-31) 29 3.3 SB_42203| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_24967| Best HMM Match : Drf_FH1 (HMM E-Value=0.65) 28 7.6 >SB_29492| Best HMM Match : Ribosomal_S3_C (HMM E-Value=1.8e-28) Length = 240 Score = 336 bits (825), Expect = 1e-92 Identities = 164/183 (89%), Positives = 173/183 (94%) Frame = +2 Query: 47 ISKKRKFVGDGVFKAELNEFLTRELAEDGYSGVEVRVTPIRSEIIIMATRTQSVLGEKGR 226 ISKKRKFV DG+FKAELNEFLTRELAEDGYSGVEVRVTPIR+EIII+ATRTQ+VLGEKGR Sbjct: 5 ISKKRKFVADGLFKAELNEFLTRELAEDGYSGVEVRVTPIRTEIIILATRTQNVLGEKGR 64 Query: 227 RIRELTSVVQKRFNIPEQSVELYAEKVATRGLCAIAQAESLRYKLIGGLAVRRACYGVLR 406 RIRELTSVVQKRF PE SVELYAEKVATRGLCAIAQ ESLRYKLIGGLAVRRACYGVLR Sbjct: 65 RIRELTSVVQKRFGFPEGSVELYAEKVATRGLCAIAQCESLRYKLIGGLAVRRACYGVLR 124 Query: 407 FIMESGARGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPCNDYVNTAXRHVLLRQGVLGI 586 FIMESGA+GCEVVVSGKLRGQRAKSMKFVDGLM+H+G+P YV+TA RHV LRQGVLGI Sbjct: 125 FIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMVHAGEPTTHYVDTAVRHVYLRQGVLGI 184 Query: 587 KVK 595 KVK Sbjct: 185 KVK 187 >SB_57373| Best HMM Match : DUF292 (HMM E-Value=4.7) Length = 383 Score = 29.1 bits (62), Expect = 3.3 Identities = 28/72 (38%), Positives = 39/72 (54%), Gaps = 6/72 (8%) Frame = +2 Query: 101 EFLTRELAEDGYSGVEVR--VTPIR----SEIIIMATRTQSVLGEKGRRIRELTSVVQKR 262 E+L R++ D YS E +TP +IMA R QSVL ++GR +LT Q+R Sbjct: 175 EYLQRKI-NDAYSPEEAEKNITPYSLCSYENPMIMAFRLQSVLRKRGR--DDLT-WAQQR 230 Query: 263 FNIPEQSVELYA 298 F+ SVE +A Sbjct: 231 FDDLADSVEQFA 242 >SB_28852| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3172 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/70 (22%), Positives = 34/70 (48%) Frame = +2 Query: 131 GYSGVEVRVTPIRSEIIIMATRTQSVLGEKGRRIRELTSVVQKRFNIPEQSVELYAEKVA 310 GY+ + + S +++ A +++ ++ + +RE +QKRF E+ +Y Sbjct: 1941 GYTARKEYSRCVTSIVLMQALVRRNLAVKRYQALREAAIGIQKRFRAKEEGKLVYLMFHI 2000 Query: 311 TRGLCAIAQA 340 RG C + Q+ Sbjct: 2001 QRGACIVIQS 2010 >SB_3270| Best HMM Match : MMPL (HMM E-Value=0.68) Length = 401 Score = 29.1 bits (62), Expect = 3.3 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +1 Query: 451 WQAAWSTCQINEVCRWTHDPLW 516 W+ AW+ C + E +T++P W Sbjct: 76 WKQAWTPCSLQETTIYTNNPPW 97 >SB_51602| Best HMM Match : Glyco_hydro_38C (HMM E-Value=1.1e-31) Length = 976 Score = 29.1 bits (62), Expect = 3.3 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = +1 Query: 445 CIWQAAWSTCQINEVCRWTHDPLWRP 522 C W + W + E WTH P RP Sbjct: 185 CRWLSQWKQSEEEESVLWTHSPARRP 210 >SB_42203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/41 (26%), Positives = 19/41 (46%) Frame = +1 Query: 310 YSWSLRYRPGRISKIQAYRRSRCTSCLLWCSPFHHGIWRPW 432 Y+W L + P + ++ Y R + L C+P + W W Sbjct: 4 YNWWLAWNPALLCLMRQYNRWLAWNPALLCNPRQYNRWLAW 44 >SB_24967| Best HMM Match : Drf_FH1 (HMM E-Value=0.65) Length = 1799 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/21 (57%), Positives = 18/21 (85%) Frame = +3 Query: 12 LGSRLQSWP*TIFQRSENLLE 74 LGSR+QS+P +I+Q +EN +E Sbjct: 406 LGSRMQSYPTSIWQDTENGIE 426 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,727,049 Number of Sequences: 59808 Number of extensions: 460878 Number of successful extensions: 1335 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1202 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1331 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -