BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P05_F_A23 (653 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y09952-1|CAA71083.1| 115|Anopheles gambiae histone H3 protein. 24 3.7 AY035716-1|AAK61362.1| 136|Anopheles gambiae histone 3A protein. 24 3.7 >Y09952-1|CAA71083.1| 115|Anopheles gambiae histone H3 protein. Length = 115 Score = 24.2 bits (50), Expect = 3.7 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +1 Query: 304 GGYSWSLRYRPGRISKIQAYRRSRCTSCLLWCSPF 408 GG RYRPG ++ + R + T L+ PF Sbjct: 32 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 66 >AY035716-1|AAK61362.1| 136|Anopheles gambiae histone 3A protein. Length = 136 Score = 24.2 bits (50), Expect = 3.7 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +1 Query: 304 GGYSWSLRYRPGRISKIQAYRRSRCTSCLLWCSPF 408 GG RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 721,738 Number of Sequences: 2352 Number of extensions: 15076 Number of successful extensions: 21 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -