BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P05_F_A23 (653 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 25 0.84 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 25 0.84 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 24 1.5 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 22 4.5 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 21 7.9 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 24.6 bits (51), Expect = 0.84 Identities = 13/50 (26%), Positives = 21/50 (42%) Frame = -2 Query: 511 VDHESIYKLH*FGTLTTQLARYNNFTTTGARFHDETENTIASTTYSETSD 362 VD + K T+ T L +Y N+T F + + TY +T + Sbjct: 1162 VDEMEVRKTSALTTVLTGLRKYTNYTIQVLAFTRVGDGVPTTVTYCQTEE 1211 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 24.6 bits (51), Expect = 0.84 Identities = 13/50 (26%), Positives = 21/50 (42%) Frame = -2 Query: 511 VDHESIYKLH*FGTLTTQLARYNNFTTTGARFHDETENTIASTTYSETSD 362 VD + K T+ T L +Y N+T F + + TY +T + Sbjct: 1158 VDEMEVRKTSALTTVLTGLRKYTNYTIQVLAFTRVGDGVPTTVTYCQTEE 1207 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +1 Query: 148 SPGHSHPLGDHYYGHQDTKCARRERT 225 S H PL +H Y D+ + ERT Sbjct: 1323 SEDHRRPLSEHIYSSIDSDYSTLERT 1348 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = +2 Query: 17 LPLAIMAVNNISKKRKFVGDGVFKAELNEFLTR 115 +PL I V + K KF+ + K N+ +T+ Sbjct: 100 MPLLINVVKYLGGKHKFISKKIKKTMENKDITK 132 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -2 Query: 331 DSAKTTSSHLFSIQFYRLLWNVESLLYYGSQ 239 D + S+H +I Y LW ++S L +Q Sbjct: 122 DCSGIVSAHKIAIDEYERLWVLDSGLVNNTQ 152 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,714 Number of Sequences: 438 Number of extensions: 3776 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -