BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P05_F_A20 (652 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-13|CAJ14164.1| 420|Anopheles gambiae predicted protein... 43 1e-05 AY428512-1|AAR89530.1| 420|Anopheles gambiae EKN1 protein. 43 1e-05 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 33 0.010 AY745224-1|AAU93491.1| 103|Anopheles gambiae cytochrome P450 pr... 27 0.39 AY313948-1|AAP76391.1| 424|Anopheles gambiae cytochrome P450 CY... 23 6.3 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 8.4 >CR954257-13|CAJ14164.1| 420|Anopheles gambiae predicted protein protein. Length = 420 Score = 42.7 bits (96), Expect = 1e-05 Identities = 27/92 (29%), Positives = 45/92 (48%) Frame = +2 Query: 95 EDLVPKSPESLAEEKKDSGNYLYKFKNYKGALAMYDEAIKLCPENAAYYGNRSACYMMLC 274 +DL P E E K G+ ++ +N+ A++ Y I+L + A + NRSA ++ L Sbjct: 274 DDLRPD--ERNPEWLKQRGDTFFQQRNFLAAISAYSAGIRLTKDYYALFLNRSAAHLALE 331 Query: 275 MYKKALEDAQKAVSLDPTFTKGYIRAAKCCIA 370 Y++ ED A+ L + RA C+A Sbjct: 332 NYQRCAEDCSTALELLQPPVEANRRARVACLA 363 >AY428512-1|AAR89530.1| 420|Anopheles gambiae EKN1 protein. Length = 420 Score = 42.7 bits (96), Expect = 1e-05 Identities = 27/92 (29%), Positives = 45/92 (48%) Frame = +2 Query: 95 EDLVPKSPESLAEEKKDSGNYLYKFKNYKGALAMYDEAIKLCPENAAYYGNRSACYMMLC 274 +DL P E E K G+ ++ +N+ A++ Y I+L + A + NRSA ++ L Sbjct: 274 DDLRPD--ERNPEWLKQRGDTFFQQRNFLAAISAYSAGIRLTKDYYALFLNRSAAHLALE 331 Query: 275 MYKKALEDAQKAVSLDPTFTKGYIRAAKCCIA 370 Y++ ED A+ L + RA C+A Sbjct: 332 NYQRCAEDCSTALELLQPPVEANRRARVACLA 363 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 32.7 bits (71), Expect = 0.010 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = +2 Query: 170 KNYKGALAMYDEAIKLCPE-NAAYYGNRSACYMMLCMYKKALEDAQKAVSLDP 325 K+Y+GALA Y +A++ P AA C++ L KA Q+A+ L+P Sbjct: 176 KDYRGALAFYKKALRTNPNCPAAVRLGMGHCFLKLSNPDKAKLAFQRALDLEP 228 >AY745224-1|AAU93491.1| 103|Anopheles gambiae cytochrome P450 protein. Length = 103 Score = 27.5 bits (58), Expect = 0.39 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +3 Query: 108 PKARRAWLKKKKTVVIIYISLKITKEHW 191 PK R+ ++KK TVV+ Y S+ EH+ Sbjct: 2 PKDRKIFVKKGTTVVLPYYSICFDAEHF 29 >AY313948-1|AAP76391.1| 424|Anopheles gambiae cytochrome P450 CYP6M4 protein. Length = 424 Score = 23.4 bits (48), Expect = 6.3 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +2 Query: 347 RAAKCCIALGDLLNGEQAVRRATELGGVECVSGE 448 +A KC + + NGE A E+ +ECV E Sbjct: 269 KARKCVTDVLERHNGELTYEAAMEMDYLECVLKE 302 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 23.0 bits (47), Expect = 8.4 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +1 Query: 331 HQRIHTGCEMLYCVRRSIK 387 HQ++H +LYC R+++ Sbjct: 428 HQQVHNQQRILYCFCRNVE 446 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 646,409 Number of Sequences: 2352 Number of extensions: 13596 Number of successful extensions: 26 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -