BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P05_F_A16 (654 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 26 1.2 AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein... 25 2.1 AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylch... 24 3.7 AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylch... 24 3.7 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 25.8 bits (54), Expect = 1.2 Identities = 16/69 (23%), Positives = 29/69 (42%), Gaps = 1/69 (1%) Frame = -1 Query: 492 LQWSDAVISCTGLWLILN-SPICSQCSPYMCHRQTN*EFLNELHKVHSPAL*YLASLIAR 316 ++W+ VI G W + N + S + E+LN++ SPA ++ Sbjct: 906 VRWAHLVIPDVGAWQLRNHGEVTFHLSQVLSGHGFLREYLNKMRFTSSPACPRCPGVVEG 965 Query: 315 RKHALLEPP 289 +H + E P Sbjct: 966 VEHVMFECP 974 >AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein coupled receptor protein. Length = 695 Score = 25.0 bits (52), Expect = 2.1 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 212 SPSRTVCPFSKGS 250 SP+ TVCP SKG+ Sbjct: 617 SPNATVCPMSKGA 629 >AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 24.2 bits (50), Expect = 3.7 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +3 Query: 339 IKELESGPYATHLKTLNLFAYGTYKDYIENKSDYLEL 449 IK+ GP+ L L Y T + + N+SD LE+ Sbjct: 15 IKDSLQGPHEKRLLNNLLATYNTLERPVANESDPLEV 51 >AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 24.2 bits (50), Expect = 3.7 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +3 Query: 339 IKELESGPYATHLKTLNLFAYGTYKDYIENKSDYLEL 449 IK+ GP+ L L Y T + + N+SD LE+ Sbjct: 15 IKDSLQGPHEKRLLNNLLATYNTLERPVANESDPLEV 51 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 660,884 Number of Sequences: 2352 Number of extensions: 12496 Number of successful extensions: 20 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -