BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P05_F_A12 (653 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g49510.1 68418.m06127 VHL binding protein, putative / prefold... 103 1e-22 At1g06530.1 68414.m00692 myosin heavy chain-related similar to m... 43 2e-04 At5g62250.1 68418.m07816 microtubule associated protein (MAP65/A... 34 0.072 At2g25140.1 68415.m03007 heat shock protein 100, putative / HSP1... 33 0.13 At1g68790.1 68414.m07863 expressed protein 33 0.22 At3g53260.1 68416.m05870 phenylalanine ammonia-lyase 2 (PAL2) ne... 31 0.88 At2g37040.1 68415.m04544 phenylalanine ammonia-lyase 1 (PAL1) ne... 30 1.5 At5g06060.1 68418.m00671 tropinone reductase, putative / tropine... 29 2.0 At1g75150.1 68414.m08729 expressed protein ; expression supporte... 29 2.0 At1g63300.1 68414.m07156 expressed protein similar to Intracellu... 29 2.0 At1g61290.1 68414.m06908 syntaxin, putative (SYP124) similar to ... 29 2.0 At3g53120.1 68416.m05854 expressed protein 29 2.7 At3g10340.1 68416.m01240 phenylalanine ammonia-lyase, putative s... 29 2.7 At3g47060.1 68416.m05110 FtsH protease, putative contains simila... 29 3.6 At2g29330.1 68415.m03562 tropinone reductase, putative / tropine... 28 4.7 At1g60200.1 68414.m06781 splicing factor PWI domain-containing p... 28 6.2 At1g10950.1 68414.m01257 endomembrane protein 70, putative 28 6.2 At3g19720.2 68416.m02498 dynamin family protein identical to cDN... 27 8.2 At3g19720.1 68416.m02497 dynamin family protein identical to cDN... 27 8.2 At1g30190.1 68414.m03690 expressed protein ; expression supporte... 27 8.2 >At5g49510.1 68418.m06127 VHL binding protein, putative / prefoldin, putative similar to Swiss-Prot:Q15765 prefoldin subunit 3 (Von Hippel-Lindau binding protein 1; VHL binding protein-1; VBP-1; HIBBJ46) [Mus musculus] Length = 195 Score = 103 bits (246), Expect = 1e-22 Identities = 57/146 (39%), Positives = 90/146 (61%), Gaps = 5/146 (3%) Frame = +1 Query: 229 GIPEAEFVDNVDEFMKSPINAEGVDV--VLKSLDEKHRKYKVMEYTLATKRRRLRQQIPD 402 GIP A+F+ +V+ ++ G+D L E+ ++YKV+E L ++R L+ +IPD Sbjct: 18 GIPAAKFIQDVETYLSQ----SGLDPNSALAFHQERLQQYKVVEMKLLAQQRDLQAKIPD 73 Query: 403 LARTIEVIEKLKEQK---EEVETQFLLSDQVFVKANVPPTKSVCLWLGANVMLEYSLEDA 573 + + +EV+ L+ +K E + F +S+ ++ +A + T SVCLWLGANVMLEYS E+A Sbjct: 74 IEKCLEVVATLEAKKGTGEALLADFEVSEGIYSRACIEDTDSVCLWLGANVMLEYSCEEA 133 Query: 574 EKLLTTNMETAQENLNQVEHDLDFLR 651 LL N+E A+ +L + DL FLR Sbjct: 134 SALLKNNLENAKASLEVLVADLQFLR 159 >At1g06530.1 68414.m00692 myosin heavy chain-related similar to myosin heavy chain (GI:1408194) {Placopecten magellanicus}; similar to Myosin heavy chain, clone 203 (Fragment) (SP:P39922){Hydra attenuata}; contains one transmembrane domain Length = 323 Score = 42.7 bits (96), Expect = 2e-04 Identities = 36/152 (23%), Positives = 78/152 (51%), Gaps = 1/152 (0%) Frame = +1 Query: 178 IKMEGDGVEPSNPKSYSGIPEAEFVDNVDEFMKSPINAEGVDVVLKSLDEKHRKYKVMEY 357 I +G G+E K +G+ + + ++ MK + G + +K LDEK++K++ E Sbjct: 139 ISQKGGGIEELE-KEVAGLRTVK--EENEKRMKELESKLGA-LEVKELDEKNKKFRAEE- 193 Query: 358 TLATKRRRLRQQIPDLARTIEVIEKLKEQKEEVETQFLLSDQVFVKANVPPTKSVCLWLG 537 + K +++ DL I+ +E K + E Q +++++ V+ ++ ++ + L Sbjct: 194 EMREKIDNKEKEVHDLKEKIKSLES-DVAKGKTELQKWITEKMVVEDSLKDSEKKVVALE 252 Query: 538 ANVM-LEYSLEDAEKLLTTNMETAQENLNQVE 630 + ++ L+ L+DAEK++ +E LN +E Sbjct: 253 SEIVELQKQLDDAEKMINGLKNVVEEPLNGIE 284 >At5g62250.1 68418.m07816 microtubule associated protein (MAP65/ASE1) family protein low similarity to protein regulating cytokinesis 1 (PRC1) [Homo sapiens] GI:2865521; contains Pfam profile PF03999: Microtubule associated protein (MAP65/ASE1 family) Length = 549 Score = 34.3 bits (75), Expect = 0.072 Identities = 20/53 (37%), Positives = 30/53 (56%) Frame = +1 Query: 262 DEFMKSPINAEGVDVVLKSLDEKHRKYKVMEYTLATKRRRLRQQIPDLARTIE 420 DE S +A+ D+ L+ L+E HR+ YTL ++R +QI D RT+E Sbjct: 145 DETCSSDFSADESDLSLRKLEELHREL----YTLQEQKRNRVKQIQDNIRTLE 193 >At2g25140.1 68415.m03007 heat shock protein 100, putative / HSP100, putative / heat shock protein clpB, putative / HSP100/ClpB, putative similar to HSP100/ClpB GI:9651530 [Phaseolus lunatus] Length = 964 Score = 33.5 bits (73), Expect = 0.13 Identities = 31/130 (23%), Positives = 64/130 (49%), Gaps = 2/130 (1%) Frame = +1 Query: 259 VDEFMKSPINAEGVDVVLKSLDEKHRKYKV--MEYTLATKRRRLRQQIPDLARTIEVIEK 432 +D ++ I E + LK+ +K K ++ +E L+T +++ ++ + ++ K Sbjct: 493 LDGIDRAVIKLEMEKLSLKNDTDKASKERLQKIENDLSTLKQKQKELNVQWEKEKSLMTK 552 Query: 433 LKEQKEEVETQFLLSDQVFVKANVPPTKSVCLWLGANVMLEYSLEDAEKLLTTNMETAQE 612 ++ KEE++ L + + ++ ++ L G + L+ LE+AEK LT + Q Sbjct: 553 IRSFKEEIDRVNLEIESAEREYDL--NRAAELKYGTLLSLQRQLEEAEKNLTNFRQFGQS 610 Query: 613 NLNQVEHDLD 642 L +V DLD Sbjct: 611 LLREVVTDLD 620 >At1g68790.1 68414.m07863 expressed protein Length = 1085 Score = 32.7 bits (71), Expect = 0.22 Identities = 18/58 (31%), Positives = 29/58 (50%) Frame = +1 Query: 292 EGVDVVLKSLDEKHRKYKVMEYTLATKRRRLRQQIPDLARTIEVIEKLKEQKEEVETQ 465 EGV K LD + + K E L + ++L + L E + KLK++ EE+ T+ Sbjct: 415 EGVKKKEKDLDARLKTVKEKEKALKAEEKKLHMENERLLEDKECLRKLKDEIEEIGTE 472 >At3g53260.1 68416.m05870 phenylalanine ammonia-lyase 2 (PAL2) nearly identical to SP|P45724 Length = 717 Score = 30.7 bits (66), Expect = 0.88 Identities = 18/50 (36%), Positives = 27/50 (54%) Frame = -1 Query: 293 SALIGDFINSSTLSTNSASGIPEYDLGFEGSTPSPSIFIYCEVYIQFLEN 144 S L+ DF N+ S +AS P D GF+G+ ++ YC +Q+L N Sbjct: 429 SELVNDFYNNGLPSNLTASSNPSLDYGFKGA--EIAMASYCS-ELQYLAN 475 >At2g37040.1 68415.m04544 phenylalanine ammonia-lyase 1 (PAL1) nearly identical to SP|P35510 Length = 725 Score = 29.9 bits (64), Expect = 1.5 Identities = 18/50 (36%), Positives = 27/50 (54%) Frame = -1 Query: 293 SALIGDFINSSTLSTNSASGIPEYDLGFEGSTPSPSIFIYCEVYIQFLEN 144 S L+ DF N+ S +AS P D GF+G+ ++ YC +Q+L N Sbjct: 437 SELVNDFYNNGLPSNLTASRNPSLDYGFKGA--EIAMASYCS-ELQYLAN 483 >At5g06060.1 68418.m00671 tropinone reductase, putative / tropine dehydrogenase, putative similar to tropinone reductase SP:P50165 from [Datura stramonium] Length = 264 Score = 29.5 bits (63), Expect = 2.0 Identities = 16/39 (41%), Positives = 27/39 (69%), Gaps = 3/39 (7%) Frame = +1 Query: 532 LGANVM---LEYSLEDAEKLLTTNMETAQENLNQVEHDL 639 +G NV +EYS E+ K+++TN+E+A +L+Q+ H L Sbjct: 97 VGTNVRKPTVEYSSEEYAKIMSTNLESA-FHLSQIAHPL 134 >At1g75150.1 68414.m08729 expressed protein ; expression supported by MPSS Length = 753 Score = 29.5 bits (63), Expect = 2.0 Identities = 18/72 (25%), Positives = 34/72 (47%), Gaps = 2/72 (2%) Frame = +1 Query: 262 DEFMKSPINAEGVDVVLKSLDEKHRKYKVMEYTLATKRRRLRQQIPDLART--IEVIEKL 435 D+F + P++ +++ K E + + L + R + L R V+EK+ Sbjct: 197 DDFDELPVSTASMNMTKKERREYLDQLRAENQRLLRETRDAAFEAAPLVRKPISSVLEKI 256 Query: 436 KEQKEEVETQFL 471 + +KEE+ QFL Sbjct: 257 RRRKEEISKQFL 268 >At1g63300.1 68414.m07156 expressed protein similar to Intracellular protein transport protein USO1 (Swiss-Prot:P25386) [Saccharomyces cerevisiae]; similar to Myosin II heavy chain, non muscle (Swiss-Prot:P08799) [Dictyostelium discoideum] Length = 1029 Score = 29.5 bits (63), Expect = 2.0 Identities = 22/86 (25%), Positives = 40/86 (46%) Frame = +1 Query: 244 EFVDNVDEFMKSPINAEGVDVVLKSLDEKHRKYKVMEYTLATKRRRLRQQIPDLARTIEV 423 E DN++E M+ +E + D+K + V ++ A L Q+I DL IE+ Sbjct: 424 EGADNIEESMRRSCRSETDE---DDHDQKALEDLVKKHVDAKDTHILEQKITDLYNEIEI 480 Query: 424 IEKLKEQKEEVETQFLLSDQVFVKAN 501 ++ K++ E Q L ++ + N Sbjct: 481 YKRDKDELEIQMEQLALDYEILKQQN 506 >At1g61290.1 68414.m06908 syntaxin, putative (SYP124) similar to syntaxin-related protein Nt-syr1 GI:4206787 from [Nicotiana tabacum] Length = 303 Score = 29.5 bits (63), Expect = 2.0 Identities = 14/58 (24%), Positives = 32/58 (55%) Frame = +1 Query: 286 NAEGVDVVLKSLDEKHRKYKVMEYTLATKRRRLRQQIPDLARTIEVIEKLKEQKEEVE 459 N +GV+ + KSL + + + K + K R + D+A+ ++ ++ +K++ E +E Sbjct: 46 NMKGVETLYKSLQDSNEECKTVHNAKKVKELRAKMD-GDVAQVLKRVKMIKQKLEALE 102 >At3g53120.1 68416.m05854 expressed protein Length = 217 Score = 29.1 bits (62), Expect = 2.7 Identities = 26/81 (32%), Positives = 43/81 (53%), Gaps = 7/81 (8%) Frame = +1 Query: 409 RTIEVIEKLKEQKEEVETQFLLS-DQVFVKANVPPT-KSVCLWLGA-NVMLEYSLEDAEK 579 ++++ + KL K+ + QFLLS DQV V+ N+ + L L N+ E + + Sbjct: 65 KSVDELRKLLSDKDAYQ-QFLLSLDQVKVQNNIKDELRRETLQLARDNLEKEPQIMELRN 123 Query: 580 ----LLTTNMETAQENLNQVE 630 + TT + TAQE LN++E Sbjct: 124 QCRIIRTTELATAQEKLNELE 144 >At3g10340.1 68416.m01240 phenylalanine ammonia-lyase, putative similar to phenylalanine ammonia-lyase GB:S48726 [Petroselinum crispum] Length = 707 Score = 29.1 bits (62), Expect = 2.7 Identities = 18/50 (36%), Positives = 25/50 (50%) Frame = -1 Query: 293 SALIGDFINSSTLSTNSASGIPEYDLGFEGSTPSPSIFIYCEVYIQFLEN 144 S L+ DF N+ S S P D GF+G+ ++ YC +QFL N Sbjct: 419 SELVNDFYNNGLPSNLSGGRNPSLDYGFKGA--EIAMASYCS-ELQFLAN 465 >At3g47060.1 68416.m05110 FtsH protease, putative contains similarity to FtsH protease GI:13183728 from [Medicago sativa] Length = 802 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = +1 Query: 196 GVEPSNPKSYSGIPEAEFVDNVDEFMKSPINAEGVDVVLKSLDE 327 G EP ++ +P +EF+ V+ + +GV V+ K D+ Sbjct: 165 GSEPRIQTTFVSVPYSEFLSKVNSNQVQKVEVDGVQVLFKLRDD 208 >At2g29330.1 68415.m03562 tropinone reductase, putative / tropine dehydrogenase, putative similar to tropinone reductase SP:P50165 from [Datura stramonium] Length = 260 Score = 28.3 bits (60), Expect = 4.7 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = +1 Query: 550 LEYSLEDAEKLLTTNMETAQENLNQVEHDL 639 +EY ED L++TN+E+A +L+Q+ H L Sbjct: 104 IEYEAEDFSFLISTNLESAY-HLSQLSHPL 132 >At1g60200.1 68414.m06781 splicing factor PWI domain-containing protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF01480: PWI domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 899 Score = 27.9 bits (59), Expect = 6.2 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +1 Query: 370 KRRRLRQQIPDLARTIEVIEKLKEQKEEVETQFLLSDQV 486 +RR+LR++ DLA ++ E++ E K E Q L Q+ Sbjct: 539 RRRQLREKEDDLADRLKEEEEVAEAKRSAEEQNLQQQQL 577 >At1g10950.1 68414.m01257 endomembrane protein 70, putative Length = 589 Score = 27.9 bits (59), Expect = 6.2 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = -3 Query: 255 IYKFSFWYSRIRLRVRGFYSVSFHF 181 +Y +S +Y ++ ++ GF+ SF+F Sbjct: 529 VYLYSIYYYYVKTKMSGFFQTSFYF 553 >At3g19720.2 68416.m02498 dynamin family protein identical to cDNA dynamin-like protein (ARC5) GI: 30349145; contains Pfam profile PF00350: Dynamin family Length = 741 Score = 27.5 bits (58), Expect = 8.2 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = +1 Query: 352 EYTLATKRRRLRQQIPDLARTIEVIEKL 435 ++++AT RR + Q P+L+RTI V KL Sbjct: 206 DWSIATTRRIVMQVDPELSRTIVVSTKL 233 >At3g19720.1 68416.m02497 dynamin family protein identical to cDNA dynamin-like protein (ARC5) GI: 30349145; contains Pfam profile PF00350: Dynamin family Length = 777 Score = 27.5 bits (58), Expect = 8.2 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = +1 Query: 352 EYTLATKRRRLRQQIPDLARTIEVIEKL 435 ++++AT RR + Q P+L+RTI V KL Sbjct: 206 DWSIATTRRIVMQVDPELSRTIVVSTKL 233 >At1g30190.1 68414.m03690 expressed protein ; expression supported by MPSS Length = 278 Score = 27.5 bits (58), Expect = 8.2 Identities = 17/57 (29%), Positives = 31/57 (54%) Frame = +1 Query: 313 KSLDEKHRKYKVMEYTLATKRRRLRQQIPDLARTIEVIEKLKEQKEEVETQFLLSDQ 483 +S +K R+ ++ T TKR+ ++ D +R + + EK + KEE E LS++ Sbjct: 195 RSKSDKPRRKRLSVDTETTKRKSYGRKKSDCSRWMVIPEKWEYVKEESEEFSKLSNE 251 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,161,173 Number of Sequences: 28952 Number of extensions: 201063 Number of successful extensions: 739 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 720 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 737 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -