BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P05_F_A10 (402 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40594| Best HMM Match : Extensin_2 (HMM E-Value=0.083) 110 5e-25 SB_10357| Best HMM Match : zf-C2H2 (HMM E-Value=9.8e-38) 36 0.012 SB_34562| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.087 SB_45463| Best HMM Match : zf-C2H2 (HMM E-Value=0) 31 0.46 SB_39159| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.61 SB_55441| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.61 SB_16971| Best HMM Match : zf-C2H2 (HMM E-Value=5.8e-36) 30 0.81 SB_44730| Best HMM Match : zf-C2H2 (HMM E-Value=0) 30 0.81 SB_50183| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 1.1 SB_42899| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.1 SB_34420| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.1 SB_38457| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 1.1 SB_15809| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 1.4 SB_11426| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_27848| Best HMM Match : zf-C2H2 (HMM E-Value=1.49995e-41) 29 1.9 SB_57| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 1.9 SB_13281| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.5 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 3.3 SB_23259| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 3.3 SB_51905| Best HMM Match : zf-C2H2 (HMM E-Value=0) 27 4.3 SB_37930| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_16305| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_32609| Best HMM Match : zf-C2H2 (HMM E-Value=0) 27 4.3 SB_11362| Best HMM Match : zf-C2H2 (HMM E-Value=7.9e-32) 27 4.3 SB_32644| Best HMM Match : zf-C2H2 (HMM E-Value=0) 27 5.7 SB_21010| Best HMM Match : PHD (HMM E-Value=7e-10) 27 5.7 SB_14666| Best HMM Match : NHL (HMM E-Value=4.5) 27 5.7 SB_1799| Best HMM Match : zf-C2H2 (HMM E-Value=0) 27 5.7 SB_46756| Best HMM Match : zf-C2H2 (HMM E-Value=4.60046e-42) 27 5.7 SB_40339| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.7 SB_37978| Best HMM Match : zf-C2H2 (HMM E-Value=0) 27 5.7 SB_34111| Best HMM Match : zf-C2H2 (HMM E-Value=0) 27 5.7 SB_8757| Best HMM Match : zf-C2H2 (HMM E-Value=0) 27 5.7 SB_43276| Best HMM Match : zf-C2H2 (HMM E-Value=0) 27 7.6 SB_32903| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_8854| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_3588| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_57933| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_52567| Best HMM Match : zf-C2H2 (HMM E-Value=0) 26 10.0 SB_9634| Best HMM Match : zf-C2H2 (HMM E-Value=0) 26 10.0 SB_2814| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 10.0 SB_27651| Best HMM Match : zf-C2H2 (HMM E-Value=0) 26 10.0 SB_22641| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 10.0 SB_11871| Best HMM Match : zf-C2H2 (HMM E-Value=1.3e-13) 26 10.0 SB_5864| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 10.0 SB_2816| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 10.0 >SB_40594| Best HMM Match : Extensin_2 (HMM E-Value=0.083) Length = 440 Score = 110 bits (264), Expect = 5e-25 Identities = 48/74 (64%), Positives = 56/74 (75%), Gaps = 1/74 (1%) Frame = +1 Query: 181 VGRRRRHP-NLGAGIVTXXFDDEKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKE 357 +GR+++ P FDDEKILIQHQKAKHFKC ICHKKLYTGPGL+IHC QVHKE Sbjct: 1 MGRKKKKPMKPWCWYCNRDFDDEKILIQHQKAKHFKCMICHKKLYTGPGLAIHCTQVHKE 60 Query: 358 AIDXVPNSLPNRSN 399 + +PNSLPNR + Sbjct: 61 TVSAIPNSLPNRGD 74 Score = 44.0 bits (99), Expect = 5e-05 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 177 MGRKKKKASKPWCWYCN 227 MGRKKKK KPWCWYCN Sbjct: 1 MGRKKKKPMKPWCWYCN 17 >SB_10357| Best HMM Match : zf-C2H2 (HMM E-Value=9.8e-38) Length = 509 Score = 35.9 bits (79), Expect = 0.012 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 H K K FKCHICH++ ++ H M++H Sbjct: 421 HSKEKPFKCHICHRRFAQSSSVTTH-MRIH 449 >SB_34562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 978 Score = 33.1 bits (72), Expect = 0.087 Identities = 16/53 (30%), Positives = 25/53 (47%) Frame = +1 Query: 241 DEKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAIDXVPNSLPNRSN 399 D I + H + K FKC CHK + H + H +A P+S ++S+ Sbjct: 286 DLHIKVVHNRVKAFKCEHCHKVFGHSFDRARHVKKFHSDAKPVTPSSQSDQSH 338 >SB_45463| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 347 Score = 30.7 bits (66), Expect = 0.46 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +1 Query: 256 IQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKE 357 + H K FKCHIC K + L+ H M H E Sbjct: 276 LTHTGEKPFKCHICGKAFHQVYNLTFH-MHTHNE 308 >SB_39159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 728 Score = 30.3 bits (65), Expect = 0.61 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKE 357 H+K K +KC +C K LS H VH++ Sbjct: 658 HKKEKPYKCDVCKKIFGLSSSLSRHIRTVHQD 689 >SB_55441| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 694 Score = 30.3 bits (65), Expect = 0.61 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKE 357 H + +KC IC KK GLSIH ++H E Sbjct: 483 HTDERPYKCDICGKKFRQQGGLSIH-KKIHTE 513 Score = 27.1 bits (57), Expect = 5.7 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 H K ++C IC K L+IH M++H Sbjct: 539 HSGEKPYRCEICEKSFRDKDSLNIH-MRIH 567 >SB_16971| Best HMM Match : zf-C2H2 (HMM E-Value=5.8e-36) Length = 477 Score = 29.9 bits (64), Expect = 0.81 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 250 ILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 +L H+K + +CH+C K+ L+ H M+VH Sbjct: 294 VLHVHEKHRPHECHVCQKRFSQSSSLNKH-MRVH 326 >SB_44730| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1346 Score = 29.9 bits (64), Expect = 0.81 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +1 Query: 253 LIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHK 354 ++ H + + F C C K L HCM VH+ Sbjct: 1188 IVTHSEQRPFSCEQCMKSFNRSGDLRRHCMTVHE 1221 >SB_50183| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 717 Score = 29.5 bits (63), Expect = 1.1 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 253 LIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 L++H K FKC C K ++ L IH ++VH Sbjct: 508 LLKHTGEKKFKCAHCPKTFFSSSSLKIH-VRVH 539 >SB_42899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 490 Score = 29.5 bits (63), Expect = 1.1 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 250 ILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 +L H+K + +CH+C K+ L+ H M+VH Sbjct: 305 VLHVHEKHRPHECHVCKKRFSQSSSLNKH-MRVH 337 >SB_34420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 544 Score = 29.5 bits (63), Expect = 1.1 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Frame = +1 Query: 235 FDDEKILIQHQKAKH-----FKCHICHKKLYTGPGLSIHCMQVHK 354 FD L HQK H FKC C K LY L H VHK Sbjct: 296 FDSYNQLHNHQKTIHGGKNPFKCGHCGKCLYNESYLKEHIRGVHK 340 >SB_38457| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 4303 Score = 29.5 bits (63), Expect = 1.1 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKE 357 H+ K KC+ C KK++T G+ H QVH + Sbjct: 521 HRDEKLVKCNYC-KKIFTKYGMKEHIEQVHNK 551 Score = 27.9 bits (59), Expect = 3.3 Identities = 8/31 (25%), Positives = 19/31 (61%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHK 354 H++++ ++C C L + L++H ++HK Sbjct: 2391 HERSRPYRCEYCGWHLASKSNLTLHIKRIHK 2421 Score = 26.6 bits (56), Expect = 7.6 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +1 Query: 244 EKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKE 357 E + + H+K K + C C K+ T L H H + Sbjct: 459 EHVKVSHEKVKIYVCDHCDKEFETSCQLGSHKKVAHDQ 496 >SB_15809| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 935 Score = 29.1 bits (62), Expect = 1.4 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKE 357 H K F+C +CHK LS H VH++ Sbjct: 478 HTGEKPFECPVCHKAFSQTGNLSKHVRYVHEK 509 >SB_11426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 29.1 bits (62), Expect = 1.4 Identities = 16/60 (26%), Positives = 24/60 (40%) Frame = +1 Query: 223 VTXXFDDEKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAIDXVPNSLPNRSNI 402 + DDEK +H K F C C+K + H VHKE+ N + ++ Sbjct: 289 IQTTHDDEKPE-RHTTEKLFDCCYCNKNFTAARSVRRHIRAVHKESRSSPENKKSEKKSL 347 >SB_27848| Best HMM Match : zf-C2H2 (HMM E-Value=1.49995e-41) Length = 257 Score = 28.7 bits (61), Expect = 1.9 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 253 LIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKE 357 +I H K F+C++C K LS H M +H + Sbjct: 138 MIVHSNRKPFQCNVCEKAFKRSSTLSTH-MLIHSD 171 >SB_57| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1498 Score = 28.7 bits (61), Expect = 1.9 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 4/46 (8%) Frame = +1 Query: 235 FDDEKILIQHQKA----KHFKCHICHKKLYTGPGLSIHCMQVHKEA 360 F L++HQ++ + F C +C K L T L H M HK++ Sbjct: 1185 FSTHVYLVEHQESVLGEREFTCEVCDKSLLTRAHLKRHTMN-HKKS 1229 >SB_13281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 477 Score = 28.3 bits (60), Expect = 2.5 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +1 Query: 265 QKAKHFKCHICHKKLYTGPGLSIHCMQVHKE 357 Q + F CH+C++ L IH + VH++ Sbjct: 331 QGDRKFPCHLCNRSFEKRDRLRIHILHVHEK 361 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 27.9 bits (59), Expect = 3.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 253 LIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 L+ H K FKC +C K GL H +++H Sbjct: 469 LMMHSGQKPFKCDVCDKGFTRHAGLKSH-LRIH 500 >SB_23259| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1449 Score = 27.9 bits (59), Expect = 3.3 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +1 Query: 250 ILIQHQKAKHFKCHICHKKLYTGPGLSIH 336 + + H + F+C ICHK + L+ H Sbjct: 989 VRVHHTHERPFQCQICHKSFHMAGDLTKH 1017 >SB_51905| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 928 Score = 27.5 bits (58), Expect = 4.3 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 H AK FKC C K + L+ H VH Sbjct: 866 HSGAKPFKCDTCEKAFRSSSELTRHVKLVH 895 >SB_37930| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 707 Score = 27.5 bits (58), Expect = 4.3 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 238 DDEKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 D + ++ H K K F C C+K T L +H ++VH Sbjct: 115 DLRRHMLTHTKEKPFACSTCNKAFATKQTLIVH-IRVH 151 >SB_16305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1122 Score = 27.5 bits (58), Expect = 4.3 Identities = 18/52 (34%), Positives = 26/52 (50%) Frame = +1 Query: 247 KILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAIDXVPNSLPNRSNI 402 K + H+ K ++C C K LSIH + HKE VP P+RS++ Sbjct: 917 KHMRSHKDFKPYRCDKCDKSFNQSRLLSIHSL-THKEK-KTVPK--PSRSSV 964 >SB_32609| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1741 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 274 KHFKCHICHKKLYTGPGLSIH 336 K FKC IC K+ T GL+ H Sbjct: 1303 KLFKCDICEKEFKTHVGLNFH 1323 >SB_11362| Best HMM Match : zf-C2H2 (HMM E-Value=7.9e-32) Length = 382 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +1 Query: 247 KILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHK 354 KI + + ++CH+C + G GL+ H HK Sbjct: 324 KITHEGGELAKYECHLCGARYTRGTGLTSHLKAKHK 359 >SB_32644| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 365 Score = 27.1 bits (57), Expect = 5.7 Identities = 11/38 (28%), Positives = 18/38 (47%) Frame = +1 Query: 238 DDEKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 D +K+ ++ + F C C K T GL +H + H Sbjct: 182 DRKKLKLESESQDTFDCMSCKKVFSTPHGLEVHVRRSH 219 >SB_21010| Best HMM Match : PHD (HMM E-Value=7e-10) Length = 389 Score = 27.1 bits (57), Expect = 5.7 Identities = 12/50 (24%), Positives = 21/50 (42%), Gaps = 2/50 (4%) Frame = +1 Query: 193 RRHPNLGAGIVTXXFDDEKI--LIQHQKAKHFKCHICHKKLYTGPGLSIH 336 R P ++ E++ + + K + C IC ++ GPGL H Sbjct: 170 RPSPLFSGSMIVRNITKEELARMTPEDRKKPYVCEICGRRYKNGPGLKYH 219 >SB_14666| Best HMM Match : NHL (HMM E-Value=4.5) Length = 151 Score = 27.1 bits (57), Expect = 5.7 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +2 Query: 263 IRKRSILNVTFVTKSCTQDLDCPYTACRYIKKP*TKY 373 IR+ +++++TF + S +L P+ CR K P T Y Sbjct: 27 IRQVTVVDLTFTSDSEECNLKSPFGICRSHKDPYTLY 63 >SB_1799| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 907 Score = 27.1 bits (57), Expect = 5.7 Identities = 9/32 (28%), Positives = 14/32 (43%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKE 357 H + F+C +C K L HC + H + Sbjct: 258 HTNERLFQCDLCEKAFIDRADLRRHCQRTHSD 289 >SB_46756| Best HMM Match : zf-C2H2 (HMM E-Value=4.60046e-42) Length = 1078 Score = 27.1 bits (57), Expect = 5.7 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +1 Query: 253 LIQHQKAKHFKCHICH 300 +++H K F+CHICH Sbjct: 361 VLKHPNYKAFECHICH 376 >SB_40339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 27.1 bits (57), Expect = 5.7 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 6/45 (13%) Frame = +2 Query: 257 SNIRKRSILNVTFVTKSCTQDLDC---PYTACRYI---KKP*TKY 373 SN+ R+I V+ + KSCT + C P T RY+ K P T Y Sbjct: 3 SNLAGRTIEEVSEIIKSCTDRVICTVKPSTDFRYVDTHKTPDTDY 47 >SB_37978| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 487 Score = 27.1 bits (57), Expect = 5.7 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +1 Query: 259 QHQKAKHFKCHICHKKLYTGPGLSIHCMQVHK 354 Q++K K FKC C K L H M +HK Sbjct: 284 QNEKLKKFKCPTCDKAFIRNYTLQCH-MLIHK 314 >SB_34111| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 757 Score = 27.1 bits (57), Expect = 5.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +1 Query: 253 LIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKE 357 +++H K F C +C ++ L++H +VH E Sbjct: 545 MMRHDGVKPFSCPLCTQRFVNQSALNVH-QKVHSE 578 >SB_8757| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 539 Score = 27.1 bits (57), Expect = 5.7 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 259 QHQKAKHFKCHICHKKLYTGPGLSIH 336 +H KHFKC C+K+ + H Sbjct: 262 RHSNEKHFKCSYCNKRFVESGDMRKH 287 >SB_43276| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 426 Score = 26.6 bits (56), Expect = 7.6 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 253 LIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 L+ H K +KC +C K GL H +++H Sbjct: 282 LMMHSGQKPYKCDVCDKGFTRHAGLKSH-LRIH 313 >SB_32903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 765 Score = 26.6 bits (56), Expect = 7.6 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 H + ++F C IC+K + L H VH Sbjct: 410 HVEERNFPCEICNKAYTSDANLKAHKRSVH 439 >SB_8854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 339 Score = 26.6 bits (56), Expect = 7.6 Identities = 12/44 (27%), Positives = 18/44 (40%) Frame = +1 Query: 253 LIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAIDXVPNSL 384 ++ H K +KC IC+ K + L H H D N + Sbjct: 270 ILTHTGEKPYKCSICNWKFISSSNLRTHIRIHHSYFTDKAGNQV 313 >SB_3588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 26.6 bits (56), Expect = 7.6 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 253 LIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 L+ H K +KC +C K GL H +++H Sbjct: 247 LMMHSGQKPYKCDVCDKGFTRHAGLKSH-LRIH 278 >SB_57933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 254 Score = 26.6 bits (56), Expect = 7.6 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -2 Query: 392 LFGSEFGTXSMASLCTCMQCMDSPGPVYSF 303 ++G+E T +M C C++ GPVY F Sbjct: 123 IYGAERCTPNMHLSCLLGDCVNDYGPVYGF 152 >SB_52567| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 370 Score = 26.2 bits (55), Expect = 10.0 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCM 342 H K F CHIC K + L H + Sbjct: 282 HSTVKEFVCHICEKGFHQKGNLRNHLL 308 >SB_9634| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 587 Score = 26.2 bits (55), Expect = 10.0 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +1 Query: 256 IQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKE 357 ++H KAK C IC K L+ H + H E Sbjct: 552 LKHSKAKTHYCAICDKYYGQKSNLNTHNKKFHSE 585 >SB_2814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 896 Score = 26.2 bits (55), Expect = 10.0 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = +1 Query: 235 FDDEKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 FD ++ + H K FKC C K L H +VH Sbjct: 802 FDLKRHIRTHTGIKPFKCDRCDKAFTQRCSLEAHLTRVH 840 >SB_27651| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 280 Score = 26.2 bits (55), Expect = 10.0 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +1 Query: 265 QKAKHFKCHICHKKLYTGPGLSIHCMQVHKE 357 +K +FKC +C K GL H M+ H E Sbjct: 84 KKPDNFKCELCEKSFGYSAGLRQH-MKYHTE 113 >SB_22641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 26.2 bits (55), Expect = 10.0 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +2 Query: 248 RFSSNIRKRSILNVTFVTKSCTQDLDCPYTACRYIKK 358 R SN K+S N FVTK ++ P+ C+ IKK Sbjct: 44 RLESN--KKSNENKLFVTKKPNPTINVPWRYCKGIKK 78 >SB_11871| Best HMM Match : zf-C2H2 (HMM E-Value=1.3e-13) Length = 774 Score = 26.2 bits (55), Expect = 10.0 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +1 Query: 244 EKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHK 354 ++ L H K K CH+C K L+ H +++HK Sbjct: 704 QRHLRTHTKEKAHTCHVCGKAFGRSDHLTKH-LRIHK 739 >SB_5864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 325 Score = 26.2 bits (55), Expect = 10.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKE 357 HQ+ CH+C K+ T L +H M+ H + Sbjct: 152 HQERNPNHCHLCEKEFDTPSKLKVH-MRKHTQ 182 >SB_2816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 503 Score = 26.2 bits (55), Expect = 10.0 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = +1 Query: 235 FDDEKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 FD ++ + H K FKC C K L H +VH Sbjct: 406 FDLKRHIRTHTGIKPFKCDRCDKAFTQRCSLEAHLTRVH 444 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,626,034 Number of Sequences: 59808 Number of extensions: 172664 Number of successful extensions: 620 Number of sequences better than 10.0: 46 Number of HSP's better than 10.0 without gapping: 451 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 620 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 715479706 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -