BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P05_F_A10 (402 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC002372-1|AAH02372.1| 463|Homo sapiens zinc finger protein 207... 116 2e-26 AF046001-1|AAC78561.1| 478|Homo sapiens ZNF207 protein. 116 2e-26 AB209215-1|BAD92452.1| 496|Homo sapiens zinc finger protein 207... 116 2e-26 BT007365-1|AAP36029.1| 395|Homo sapiens zinc finger protein 207... 69 6e-12 BC008023-1|AAH08023.1| 395|Homo sapiens ZNF207 protein protein. 69 6e-12 D87073-1|BAA13242.2| 1696|Homo sapiens KIAA0236 protein. 37 0.029 DQ778127-1|ABH10109.1| 299|Homo sapiens BORIS transcription fac... 34 0.20 DQ778126-1|ABH10108.1| 422|Homo sapiens BORIS transcription fac... 34 0.20 DQ778125-1|ABH10107.1| 460|Homo sapiens BORIS transcription fac... 34 0.20 DQ778124-1|ABH10106.1| 403|Homo sapiens BORIS transcription fac... 34 0.20 DQ778123-1|ABH10105.1| 573|Homo sapiens BORIS transcription fac... 34 0.20 DQ778122-1|ABH10104.1| 627|Homo sapiens BORIS transcription fac... 34 0.20 DQ778118-1|ABH10100.1| 451|Homo sapiens BORIS transcription fac... 34 0.20 DQ778115-1|ABH10097.1| 665|Homo sapiens BORIS transcription fac... 34 0.20 DQ778111-1|ABH10093.1| 700|Homo sapiens BORIS transcription fac... 34 0.20 DQ778110-1|ABH10092.1| 663|Homo sapiens BORIS transcription fac... 34 0.20 DQ778109-1|ABH10091.1| 663|Homo sapiens BORIS transcription fac... 34 0.20 DQ778108-1|ABH10090.1| 663|Homo sapiens BORIS transcription fac... 34 0.20 BC130486-1|AAI30487.1| 663|Homo sapiens CCCTC-binding factor (z... 34 0.20 AY071919-1|AAL61541.1| 662|Homo sapiens zinc finger protein CTC... 34 0.20 AL160176-2|CAI42956.1| 663|Homo sapiens CCCTC-binding factor (z... 34 0.20 AF336042-1|AAM28645.1| 663|Homo sapiens nuclear DNA binding fac... 34 0.20 U80738-1|AAB91437.1| 182|Homo sapiens CAGH1a protein. 33 0.36 BC053361-1|AAH53361.1| 460|Homo sapiens zinc finger protein 384... 33 0.36 AK095734-1|BAC04618.1| 515|Homo sapiens NA. protein. 33 0.36 AB070238-1|BAB85125.1| 576|Homo sapiens nuclear matrix transcri... 33 0.36 AL096677-3|CAC03438.2| 711|Homo sapiens GDNF-inducible zinc fin... 31 1.1 AK056159-1|BAB71107.1| 580|Homo sapiens protein ( Homo sapiens ... 31 1.1 AB100265-1|BAC98464.1| 711|Homo sapiens GDNF-inducible zinc fin... 31 1.1 BC094708-1|AAH94708.1| 474|Homo sapiens zinc finger protein 230... 31 1.4 BC063290-1|AAH63290.1| 1066|Homo sapiens zinc finger protein 295... 31 1.4 BC050340-1|AAH50340.2| 474|Homo sapiens zinc finger protein 230... 31 1.4 AP001745-3|BAA95529.1| 1066|Homo sapiens ZNF295 protein. 31 1.4 AC067968-1|AAF66074.1| 397|Homo sapiens Zinc finger protein 230... 31 1.4 AC018725-2|AAF18685.1| 474|Homo sapiens ZNF230-like protein. 31 1.4 AB041014-1|BAD74063.1| 1066|Homo sapiens zinc finger protein lon... 31 1.4 AB033053-1|BAA86541.1| 1069|Homo sapiens KIAA1227 protein protein. 31 1.4 U25435-1|AAB07788.1| 727|Homo sapiens CTCF protein. 31 1.9 BT009915-1|AAP88917.1| 727|Homo sapiens CCCTC-binding factor (z... 31 1.9 BC127003-1|AAI27004.1| 868|Homo sapiens zinc finger protein 28 ... 31 1.9 BC127002-1|AAI27003.1| 868|Homo sapiens zinc finger protein 28 ... 31 1.9 BC041331-1|AAH41331.2| 1121|Homo sapiens ZNF335 protein protein. 31 1.9 BC014267-1|AAH14267.1| 727|Homo sapiens CCCTC-binding factor (z... 31 1.9 AL162458-3|CAC10457.1| 1342|Homo sapiens zinc finger protein 335... 31 1.9 AK026157-1|BAB15379.1| 829|Homo sapiens protein ( Homo sapiens ... 31 1.9 AF507045-1|AAM28892.1| 868|Homo sapiens zinc finger protein 28 ... 31 1.9 AF395833-1|AAN09900.1| 1342|Homo sapiens zinc-finger/leucine-zip... 31 1.9 AF226995-1|AAK28320.1| 403|Homo sapiens kruppel-like zinc finge... 31 1.9 AF145477-1|AAF31318.1| 727|Homo sapiens transcriptional repress... 31 1.9 AC007228-1|AAD23606.1| 673|Homo sapiens R31665_2 [AA 1- 673 ] p... 31 1.9 AC005498-2|AAC32423.1| 501|Homo sapiens R31665_2 protein. 31 1.9 AB209793-1|BAD93030.1| 443|Homo sapiens CCCTC-binding factor (z... 31 1.9 AB037852-1|BAA92669.1| 891|Homo sapiens KIAA1431 protein protein. 31 1.9 BC060801-1|AAH60801.1| 357|Homo sapiens DPF3 protein protein. 30 2.5 AY803021-1|AAX20019.1| 378|Homo sapiens DPF3 protein. 30 2.5 L32163-1|AAA36817.1| 622|Homo sapiens zinc finger protein protein. 29 4.4 BC121054-1|AAI21055.1| 744|Homo sapiens zinc finger protein 366... 29 4.4 BC121053-1|AAI21054.1| 744|Homo sapiens zinc finger protein 366... 29 4.4 AY458845-1|AAS13443.1| 593|Homo sapiens KRAB-domain-containing ... 29 4.4 AK097115-1|BAC04954.1| 744|Homo sapiens protein ( Homo sapiens ... 29 4.4 AF011573-1|AAB84385.1| 1029|Homo sapiens zinc finger protein pro... 29 4.4 Y18265-1|CAB41400.1| 1324|Homo sapiens zinc finger protein SALL1... 29 5.8 Y18264-1|CAB41399.1| 1324|Homo sapiens zinc finger protein SALL1... 29 5.8 BC130520-1|AAI30521.1| 1052|Homo sapiens EVI1 protein protein. 29 5.8 BC127715-1|AAI27716.1| 425|Homo sapiens FEZF1 protein protein. 29 5.8 BC127714-1|AAI27715.1| 475|Homo sapiens FEZF1 protein protein. 29 5.8 BC121038-1|AAI21039.1| 501|Homo sapiens PRDM5 protein protein. 29 5.8 BC121037-1|AAI21038.1| 599|Homo sapiens PRDM5 protein protein. 29 5.8 BC030261-1|AAH30261.1| 397|Homo sapiens ZNF222 protein protein. 29 5.8 AJ007421-1|CAB65124.1| 1272|Homo sapiens spalt-like zinc finger ... 29 5.8 AF347021-1|AAK18311.1| 1300|Homo sapiens C2H2 zinc finger protei... 29 5.8 AF272897-1|AAF78077.1| 630|Homo sapiens PR-domain zinc finger p... 29 5.8 AF187989-1|AAF04105.1| 482|Homo sapiens zinc finger protein ZNF... 29 5.8 AF187988-1|AAF04104.1| 451|Homo sapiens zinc finger protein ZNF... 29 5.8 AC067968-2|AAF66075.1| 451|Homo sapiens Zinc finger protein 222... 29 5.8 BC132818-1|AAI32819.1| 909|Homo sapiens zinc finger and BTB dom... 29 7.7 BC017234-1|AAH17234.1| 517|Homo sapiens MBD2-interacting zinc f... 29 7.7 BC012856-1|AAH12856.1| 517|Homo sapiens MBD2-interacting zinc f... 29 7.7 BC001945-1|AAH01945.1| 517|Homo sapiens MBD2-interacting zinc f... 29 7.7 BC001073-1|AAH01073.1| 517|Homo sapiens MBD2-interacting zinc f... 29 7.7 AY163816-1|AAN71742.2| 752|Homo sapiens FRBZ1 protein. 29 7.7 AL627208-1|CAI14333.1| 909|Homo sapiens zinc finger and BTB dom... 29 7.7 AL356315-1|CAI13461.1| 909|Homo sapiens zinc finger and BTB dom... 29 7.7 AK223368-1|BAD97088.1| 268|Homo sapiens snail 2 variant protein. 29 7.7 AK128549-1|BAC87496.1| 627|Homo sapiens protein ( Homo sapiens ... 29 7.7 AC007228-2|AAD23607.1| 599|Homo sapiens BC37295_1 protein. 29 7.7 >BC002372-1|AAH02372.1| 463|Homo sapiens zinc finger protein 207 protein. Length = 463 Score = 116 bits (280), Expect = 2e-26 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = +1 Query: 235 FDDEKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAIDXVPNSLPNRSNI 402 FDDEKILIQHQKAKHFKCHICHKKLYTGPGL+IHCMQVHKE ID VPN++P R++I Sbjct: 20 FDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIPGRTDI 75 Score = 43.6 bits (98), Expect = 3e-04 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 177 MGRKKKKASKPWCWYCN 227 MGRKKKK KPWCWYCN Sbjct: 1 MGRKKKKQLKPWCWYCN 17 >AF046001-1|AAC78561.1| 478|Homo sapiens ZNF207 protein. Length = 478 Score = 116 bits (280), Expect = 2e-26 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = +1 Query: 235 FDDEKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAIDXVPNSLPNRSNI 402 FDDEKILIQHQKAKHFKCHICHKKLYTGPGL+IHCMQVHKE ID VPN++P R++I Sbjct: 20 FDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIPGRTDI 75 Score = 43.6 bits (98), Expect = 3e-04 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 177 MGRKKKKASKPWCWYCN 227 MGRKKKK KPWCWYCN Sbjct: 1 MGRKKKKQLKPWCWYCN 17 >AB209215-1|BAD92452.1| 496|Homo sapiens zinc finger protein 207 variant protein. Length = 496 Score = 116 bits (280), Expect = 2e-26 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = +1 Query: 235 FDDEKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAIDXVPNSLPNRSNI 402 FDDEKILIQHQKAKHFKCHICHKKLYTGPGL+IHCMQVHKE ID VPN++P R++I Sbjct: 23 FDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIPGRTDI 78 Score = 43.6 bits (98), Expect = 3e-04 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 177 MGRKKKKASKPWCWYCN 227 MGRKKKK KPWCWYCN Sbjct: 4 MGRKKKKQLKPWCWYCN 20 >BT007365-1|AAP36029.1| 395|Homo sapiens zinc finger protein 207 protein. Length = 395 Score = 68.9 bits (161), Expect = 6e-12 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 235 FDDEKILIQHQKAKHFKCHICHKKLYTG 318 FDDEKILIQHQKAKHFKCHICHKKLYTG Sbjct: 20 FDDEKILIQHQKAKHFKCHICHKKLYTG 47 Score = 43.6 bits (98), Expect = 3e-04 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 177 MGRKKKKASKPWCWYCN 227 MGRKKKK KPWCWYCN Sbjct: 1 MGRKKKKQLKPWCWYCN 17 >BC008023-1|AAH08023.1| 395|Homo sapiens ZNF207 protein protein. Length = 395 Score = 68.9 bits (161), Expect = 6e-12 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 235 FDDEKILIQHQKAKHFKCHICHKKLYTG 318 FDDEKILIQHQKAKHFKCHICHKKLYTG Sbjct: 20 FDDEKILIQHQKAKHFKCHICHKKLYTG 47 Score = 43.6 bits (98), Expect = 3e-04 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 177 MGRKKKKASKPWCWYCN 227 MGRKKKK KPWCWYCN Sbjct: 1 MGRKKKKQLKPWCWYCN 17 >D87073-1|BAA13242.2| 1696|Homo sapiens KIAA0236 protein. Length = 1696 Score = 36.7 bits (81), Expect = 0.029 Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 2/66 (3%) Frame = +1 Query: 190 RRRHPNLGAGIVTXXFDDEKILIQHQKAKHF--KCHICHKKLYTGPGLSIHCMQVHKEAI 363 R++HP L G F L +H++ +HF +C +C GL H ++ H+E Sbjct: 1357 RKQHPRLECGACQEAFPSRLALDEHRRQQHFSHRCQLCDFAARERVGLVKHYLEQHEETS 1416 Query: 364 DXVPNS 381 V S Sbjct: 1417 AAVAAS 1422 Score = 28.7 bits (61), Expect = 7.7 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +1 Query: 253 LIQHQKAKHFKCHICHKKLYTGPGLSIHCM 342 L +H +AK + C++CH+ GL H + Sbjct: 1593 LRKHSEAKPYVCNVCHRAFRWAAGLRHHAL 1622 >DQ778127-1|ABH10109.1| 299|Homo sapiens BORIS transcription factor transcript variant B5 protein. Length = 299 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAI 363 H K ++CHICH + + IH +Q H E + Sbjct: 130 HSGEKPYECHICHTRFTQSGTMKIHILQKHGENV 163 >DQ778126-1|ABH10108.1| 422|Homo sapiens BORIS transcription factor transcript variant B4 protein. Length = 422 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAI 363 H K ++CHICH + + IH +Q H E + Sbjct: 187 HSGEKPYECHICHTRFTQSGTMKIHILQKHGENV 220 >DQ778125-1|ABH10107.1| 460|Homo sapiens BORIS transcription factor transcript variant B3 protein. Length = 460 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAI 363 H K ++CHICH + + IH +Q H E + Sbjct: 187 HSGEKPYECHICHTRFTQSGTMKIHILQKHGENV 220 >DQ778124-1|ABH10106.1| 403|Homo sapiens BORIS transcription factor transcript variant B2 protein. Length = 403 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAI 363 H K ++CHICH + + IH +Q H E + Sbjct: 130 HSGEKPYECHICHTRFTQSGTMKIHILQKHGENV 163 >DQ778123-1|ABH10105.1| 573|Homo sapiens BORIS transcription factor transcript variant A6 protein. Length = 573 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAI 363 H K ++CHICH + + IH +Q H E + Sbjct: 392 HSGEKPYECHICHTRFTQSGTMKIHILQKHGENV 425 >DQ778122-1|ABH10104.1| 627|Homo sapiens BORIS transcription factor transcript variant A5 protein. Length = 627 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAI 363 H K ++CHICH + + IH +Q H E + Sbjct: 392 HSGEKPYECHICHTRFTQSGTMKIHILQKHGENV 425 >DQ778118-1|ABH10100.1| 451|Homo sapiens BORIS transcription factor transcript variant C8 protein. Length = 451 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAI 363 H K ++CHICH + + IH +Q H E + Sbjct: 392 HSGEKPYECHICHTRFTQSGTMKIHILQKHGENV 425 >DQ778115-1|ABH10097.1| 665|Homo sapiens BORIS transcription factor transcript variant C3 protein. Length = 665 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAI 363 H K ++CHICH + + IH +Q H E + Sbjct: 392 HSGEKPYECHICHTRFTQSGTMKIHILQKHGENV 425 >DQ778111-1|ABH10093.1| 700|Homo sapiens BORIS transcription factor transcript variant B1 protein. Length = 700 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAI 363 H K ++CHICH + + IH +Q H E + Sbjct: 392 HSGEKPYECHICHTRFTQSGTMKIHILQKHGENV 425 >DQ778110-1|ABH10092.1| 663|Homo sapiens BORIS transcription factor transcript variant C1 protein. Length = 663 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAI 363 H K ++CHICH + + IH +Q H E + Sbjct: 392 HSGEKPYECHICHTRFTQSGTMKIHILQKHGENV 425 >DQ778109-1|ABH10091.1| 663|Homo sapiens BORIS transcription factor transcript variant A2 protein. Length = 663 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAI 363 H K ++CHICH + + IH +Q H E + Sbjct: 392 HSGEKPYECHICHTRFTQSGTMKIHILQKHGENV 425 >DQ778108-1|ABH10090.1| 663|Homo sapiens BORIS transcription factor transcript variant A1 protein. Length = 663 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAI 363 H K ++CHICH + + IH +Q H E + Sbjct: 392 HSGEKPYECHICHTRFTQSGTMKIHILQKHGENV 425 >BC130486-1|AAI30487.1| 663|Homo sapiens CCCTC-binding factor (zinc finger protein)-like protein. Length = 663 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAI 363 H K ++CHICH + + IH +Q H E + Sbjct: 392 HSGEKPYECHICHTRFTQSGTMKIHILQKHGENV 425 >AY071919-1|AAL61541.1| 662|Homo sapiens zinc finger protein CTCF-T protein. Length = 662 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAI 363 H K ++CHICH + + IH +Q H E + Sbjct: 392 HSGEKPYECHICHTRFTQSGTMKIHILQKHGENV 425 >AL160176-2|CAI42956.1| 663|Homo sapiens CCCTC-binding factor (zinc finger protein)-like protein. Length = 663 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAI 363 H K ++CHICH + + IH +Q H E + Sbjct: 392 HSGEKPYECHICHTRFTQSGTMKIHILQKHGENV 425 >AF336042-1|AAM28645.1| 663|Homo sapiens nuclear DNA binding factor protein. Length = 663 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAI 363 H K ++CHICH + + IH +Q H E + Sbjct: 392 HSGEKPYECHICHTRFTQSGTMKIHILQKHGENV 425 >U80738-1|AAB91437.1| 182|Homo sapiens CAGH1a protein. Length = 182 Score = 33.1 bits (72), Expect = 0.36 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 259 QHQKAKHFKCHICHKKLYTGPGLSIH 336 QH K K FKCH CH+ L +H Sbjct: 2 QHNKDKPFKCHNCHRAYTDAASLEVH 27 >BC053361-1|AAH53361.1| 460|Homo sapiens zinc finger protein 384 protein. Length = 460 Score = 33.1 bits (72), Expect = 0.36 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 259 QHQKAKHFKCHICHKKLYTGPGLSIH 336 QH K K FKCH CH+ L +H Sbjct: 280 QHNKDKPFKCHNCHRAYTDAASLEVH 305 >AK095734-1|BAC04618.1| 515|Homo sapiens NA. protein. Length = 515 Score = 33.1 bits (72), Expect = 0.36 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 259 QHQKAKHFKCHICHKKLYTGPGLSIH 336 QH K K FKCH CH+ L +H Sbjct: 335 QHNKDKPFKCHNCHRAYTDAASLEVH 360 >AB070238-1|BAB85125.1| 576|Homo sapiens nuclear matrix transcription factor4 protein. Length = 576 Score = 33.1 bits (72), Expect = 0.36 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 259 QHQKAKHFKCHICHKKLYTGPGLSIH 336 QH K K FKCH CH+ L +H Sbjct: 396 QHNKDKPFKCHNCHRAYTDAASLEVH 421 >AL096677-3|CAC03438.2| 711|Homo sapiens GDNF-inducible zinc finger protein 1 protein. Length = 711 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHK 354 H +HF C +C KK + H +QVH+ Sbjct: 371 HSSERHFPCELCGKKFKRKKDVKRHVLQVHE 401 >AK056159-1|BAB71107.1| 580|Homo sapiens protein ( Homo sapiens cDNA FLJ31597 fis, clone NT2RI2002541, weakly similar to ZINC FINGER PROTEIN 135. ). Length = 580 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHK 354 H +HF C +C KK + H +QVH+ Sbjct: 240 HSSERHFPCELCGKKFKRKKDVKRHVLQVHE 270 >AB100265-1|BAC98464.1| 711|Homo sapiens GDNF-inducible zinc finger protein 1 protein. Length = 711 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHK 354 H +HF C +C KK + H +QVH+ Sbjct: 371 HSSERHFPCELCGKKFKRKKDVKRHVLQVHE 401 >BC094708-1|AAH94708.1| 474|Homo sapiens zinc finger protein 230 protein. Length = 474 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/39 (43%), Positives = 19/39 (48%) Frame = +1 Query: 235 FDDEKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 F +K I H K FKC IC K L+ HCM VH Sbjct: 265 FQLQKHQIIHTGEKPFKCEICGKSFCLRSSLNRHCM-VH 302 >BC063290-1|AAH63290.1| 1066|Homo sapiens zinc finger protein 295 protein. Length = 1066 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 H K + C ICHK+ +T + HC H Sbjct: 569 HNPEKPYACDICHKRFHTNFKVWTHCQTQH 598 >BC050340-1|AAH50340.2| 474|Homo sapiens zinc finger protein 230 protein. Length = 474 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/39 (43%), Positives = 19/39 (48%) Frame = +1 Query: 235 FDDEKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 F +K I H K FKC IC K L+ HCM VH Sbjct: 265 FQLQKHQIIHTGEKPFKCEICGKSFCLRSSLNRHCM-VH 302 >AP001745-3|BAA95529.1| 1066|Homo sapiens ZNF295 protein. Length = 1066 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 H K + C ICHK+ +T + HC H Sbjct: 569 HNPEKPYACDICHKRFHTNFKVWTHCQTQH 598 >AC067968-1|AAF66074.1| 397|Homo sapiens Zinc finger protein 230 [amino acids 78-474] protein. Length = 397 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/39 (43%), Positives = 19/39 (48%) Frame = +1 Query: 235 FDDEKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 F +K I H K FKC IC K L+ HCM VH Sbjct: 188 FQLQKHQIIHTGEKPFKCEICGKSFCLRSSLNRHCM-VH 225 >AC018725-2|AAF18685.1| 474|Homo sapiens ZNF230-like protein. Length = 474 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/39 (43%), Positives = 19/39 (48%) Frame = +1 Query: 235 FDDEKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 F +K I H K FKC IC K L+ HCM VH Sbjct: 265 FQLQKHQIIHTGEKPFKCEICGKSFCLRSSLNRHCM-VH 302 >AB041014-1|BAD74063.1| 1066|Homo sapiens zinc finger protein long form protein. Length = 1066 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 H K + C ICHK+ +T + HC H Sbjct: 569 HNPEKPYACDICHKRFHTNFKVWTHCQTQH 598 >AB033053-1|BAA86541.1| 1069|Homo sapiens KIAA1227 protein protein. Length = 1069 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 H K + C ICHK+ +T + HC H Sbjct: 572 HNPEKPYACDICHKRFHTNFKVWTHCQTQH 601 >U25435-1|AAB07788.1| 727|Homo sapiens CTCF protein. Length = 727 Score = 30.7 bits (66), Expect = 1.9 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAI 363 H K ++C+ICH + + +H +Q H E + Sbjct: 401 HSGEKPYECYICHARFTQSGTMKMHILQKHTENV 434 >BT009915-1|AAP88917.1| 727|Homo sapiens CCCTC-binding factor (zinc finger protein) protein. Length = 727 Score = 30.7 bits (66), Expect = 1.9 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAI 363 H K ++C+ICH + + +H +Q H E + Sbjct: 401 HSGEKPYECYICHARFTQSGTMKMHILQKHTENV 434 >BC127003-1|AAI27004.1| 868|Homo sapiens zinc finger protein 28 homolog (mouse) protein. Length = 868 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 H K +KC +CHK G L++H ++H Sbjct: 527 HTGEKPYKCDVCHKSFRYGSSLTVH-QRIH 555 >BC127002-1|AAI27003.1| 868|Homo sapiens zinc finger protein 28 homolog (mouse) protein. Length = 868 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 H K +KC +CHK G L++H ++H Sbjct: 527 HTGEKPYKCDVCHKSFRYGSSLTVH-QRIH 555 >BC041331-1|AAH41331.2| 1121|Homo sapiens ZNF335 protein protein. Length = 1121 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +1 Query: 238 DDEKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 D + ++ H K K F CH+C ++ L H ++H Sbjct: 868 DLRRHMLTHTKEKPFACHLCGQRFNRNGHLKFHIQRLH 905 >BC014267-1|AAH14267.1| 727|Homo sapiens CCCTC-binding factor (zinc finger protein) protein. Length = 727 Score = 30.7 bits (66), Expect = 1.9 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAI 363 H K ++C+ICH + + +H +Q H E + Sbjct: 401 HSGEKPYECYICHARFTQSGTMKMHILQKHTENV 434 >AL162458-3|CAC10457.1| 1342|Homo sapiens zinc finger protein 335 protein. Length = 1342 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +1 Query: 238 DDEKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 D + ++ H K K F CH+C ++ L H ++H Sbjct: 1089 DLRRHMLTHTKEKPFACHLCGQRFNRNGHLKFHIQRLH 1126 >AK026157-1|BAB15379.1| 829|Homo sapiens protein ( Homo sapiens cDNA: FLJ22504 fis, clone HRC11430. ). Length = 829 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +1 Query: 238 DDEKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 D + ++ H K K F CH+C ++ L H ++H Sbjct: 576 DLRRHMLTHTKEKPFACHLCGQRFNRNGHLKFHIQRLH 613 >AF507045-1|AAM28892.1| 868|Homo sapiens zinc finger protein 28 protein. Length = 868 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 H K +KC +CHK G L++H ++H Sbjct: 527 HTGEKPYKCDVCHKSFRYGSSLTVH-QRIH 555 >AF395833-1|AAN09900.1| 1342|Homo sapiens zinc-finger/leucine-zipper co-transducer NIF1 protein. Length = 1342 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +1 Query: 238 DDEKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 D + ++ H K K F CH+C ++ L H ++H Sbjct: 1089 DLRRHMLTHTKEKPFACHLCGQRFNRNGHLKFHIQRLH 1126 >AF226995-1|AAK28320.1| 403|Homo sapiens kruppel-like zinc finger factor X6 protein. Length = 403 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 H K +KC +CHK G L++H ++H Sbjct: 82 HTGEKPYKCDVCHKSFRYGSSLTVH-QRIH 110 >AF145477-1|AAF31318.1| 727|Homo sapiens transcriptional repressor CTCF protein. Length = 727 Score = 30.7 bits (66), Expect = 1.9 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAI 363 H K ++C+ICH + + +H +Q H E + Sbjct: 401 HSGEKPYECYICHARFTQSGTMKMHILQKHTENV 434 >AC007228-1|AAD23606.1| 673|Homo sapiens R31665_2 [AA 1- 673 ] protein. Length = 673 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 H K +KC +CHK G L++H ++H Sbjct: 332 HTGEKPYKCDVCHKSFRYGSSLTVH-QRIH 360 >AC005498-2|AAC32423.1| 501|Homo sapiens R31665_2 protein. Length = 501 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 H K +KC +CHK G L++H ++H Sbjct: 332 HTGEKPYKCDVCHKSFRYGSSLTVH-QRIH 360 >AB209793-1|BAD93030.1| 443|Homo sapiens CCCTC-binding factor (zinc finger protein) variant protein. Length = 443 Score = 30.7 bits (66), Expect = 1.9 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAI 363 H K ++C+ICH + + +H +Q H E + Sbjct: 117 HSGEKPYECYICHARFTQSGTMKMHILQKHTENV 150 >AB037852-1|BAA92669.1| 891|Homo sapiens KIAA1431 protein protein. Length = 891 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 H K +KC +CHK G L++H ++H Sbjct: 550 HTGEKPYKCDVCHKSFRYGSSLTVH-QRIH 578 >BC060801-1|AAH60801.1| 357|Homo sapiens DPF3 protein protein. Length = 357 Score = 30.3 bits (65), Expect = 2.5 Identities = 19/53 (35%), Positives = 21/53 (39%), Gaps = 6/53 (11%) Frame = +1 Query: 259 QHQKAKHFKCHICHKKLYTGPGLSIHCMQVH------KEAIDXVPNSLPNRSN 399 Q K + C IC K+ PGLS H H EA D S PN N Sbjct: 191 QEDHDKPYVCDICGKRYKNRPGLSYHYAHTHLASEEGDEAQDQETRSPPNHRN 243 >AY803021-1|AAX20019.1| 378|Homo sapiens DPF3 protein. Length = 378 Score = 30.3 bits (65), Expect = 2.5 Identities = 19/53 (35%), Positives = 21/53 (39%), Gaps = 6/53 (11%) Frame = +1 Query: 259 QHQKAKHFKCHICHKKLYTGPGLSIHCMQVH------KEAIDXVPNSLPNRSN 399 Q K + C IC K+ PGLS H H EA D S PN N Sbjct: 191 QEDHDKPYVCDICGKRYKNRPGLSYHYAHTHLASEEGDEAQDQETRSPPNHRN 243 >L32163-1|AAA36817.1| 622|Homo sapiens zinc finger protein protein. Length = 622 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 4/43 (9%) Frame = +1 Query: 235 FDDEKILIQHQKA----KHFKCHICHKKLYTGPGLSIHCMQVH 351 F + LI+HQ+ K ++CH+C K L + L +H ++H Sbjct: 461 FTYNRNLIEHQRIHSGEKTYECHVCRKVLTSSRNLMVH-QRIH 502 >BC121054-1|AAI21055.1| 744|Homo sapiens zinc finger protein 366 protein. Length = 744 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +1 Query: 253 LIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKE 357 ++ HQ + KC +CHK L H MQ H E Sbjct: 300 MLTHQGTRPHKCQVCHKAFTQTSHLKRHMMQ-HSE 333 >BC121053-1|AAI21054.1| 744|Homo sapiens zinc finger protein 366 protein. Length = 744 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +1 Query: 253 LIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKE 357 ++ HQ + KC +CHK L H MQ H E Sbjct: 300 MLTHQGTRPHKCQVCHKAFTQTSHLKRHMMQ-HSE 333 >AY458845-1|AAS13443.1| 593|Homo sapiens KRAB-domain-containing zinc finger protein protein. Length = 593 Score = 29.5 bits (63), Expect = 4.4 Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 4/49 (8%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKE----AIDXVPNSLPNRS 396 H K FKC+IC K ++ L+ H M VH + D NS RS Sbjct: 281 HTGEKPFKCYICGKSFHSRSNLNRHSM-VHMQEKSFRCDTCSNSFGQRS 328 >AK097115-1|BAC04954.1| 744|Homo sapiens protein ( Homo sapiens cDNA FLJ39796 fis, clone SPLEN2005429, moderately similar to Fugu rubripes zinc finger protein. ). Length = 744 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +1 Query: 253 LIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKE 357 ++ HQ + KC +CHK L H MQ H E Sbjct: 300 MLTHQGTRPHKCQVCHKAFTQTSHLKRHMMQ-HSE 333 >AF011573-1|AAB84385.1| 1029|Homo sapiens zinc finger protein protein. Length = 1029 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 4/43 (9%) Frame = +1 Query: 235 FDDEKILIQHQKA----KHFKCHICHKKLYTGPGLSIHCMQVH 351 F + LI+HQ+ K ++CH+C K L + L +H ++H Sbjct: 855 FTYNRNLIEHQRIHSGEKTYECHVCRKVLTSSRNLMVH-QRIH 896 >Y18265-1|CAB41400.1| 1324|Homo sapiens zinc finger protein SALL1 protein. Length = 1324 Score = 29.1 bits (62), Expect = 5.8 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +1 Query: 253 LIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKE 357 L H + FKC+IC + T L +H Q HKE Sbjct: 468 LRSHTGERPFKCNICGNRFSTKGNLKVH-FQRHKE 501 >Y18264-1|CAB41399.1| 1324|Homo sapiens zinc finger protein SALL1 protein. Length = 1324 Score = 29.1 bits (62), Expect = 5.8 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +1 Query: 253 LIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKE 357 L H + FKC+IC + T L +H Q HKE Sbjct: 468 LRSHTGERPFKCNICGNRFSTKGNLKVH-FQRHKE 501 >BC130520-1|AAI30521.1| 1052|Homo sapiens EVI1 protein protein. Length = 1052 Score = 29.1 bits (62), Expect = 5.8 Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +1 Query: 256 IQHQKAKHFKCHICHKKLYTGP-GLSIHCMQVH 351 + H KH++C C K+++T P L H H Sbjct: 123 MSHDSGKHYECENCAKQVFTDPSNLQRHIRSQH 155 >BC127715-1|AAI27716.1| 425|Homo sapiens FEZF1 protein protein. Length = 425 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 256 IQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKE 357 + H K FKC+IC+K + L+ H M H + Sbjct: 314 LTHSGEKQFKCNICNKAFHQVYNLTFH-MHTHND 346 >BC127714-1|AAI27715.1| 475|Homo sapiens FEZF1 protein protein. Length = 475 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 256 IQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKE 357 + H K FKC+IC+K + L+ H M H + Sbjct: 364 LTHSGEKQFKCNICNKAFHQVYNLTFH-MHTHND 396 >BC121038-1|AAI21039.1| 501|Homo sapiens PRDM5 protein protein. Length = 501 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +1 Query: 235 FDDEKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHK 354 F ++ L+ H + FKCH C L++H VH+ Sbjct: 386 FSLQRHLLIHNSERTFKCHHCDATFKRKDTLNVHVQVVHE 425 >BC121037-1|AAI21038.1| 599|Homo sapiens PRDM5 protein protein. Length = 599 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +1 Query: 235 FDDEKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHK 354 F ++ L+ H + FKCH C L++H VH+ Sbjct: 386 FSLQRHLLIHNSERTFKCHHCDATFKRKDTLNVHVQVVHE 425 >BC030261-1|AAH30261.1| 397|Homo sapiens ZNF222 protein protein. Length = 397 Score = 29.1 bits (62), Expect = 5.8 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 H K FKC IC K L+ HCM VH Sbjct: 197 HTGEKPFKCEICGKSFCLRSSLNRHCM-VH 225 >AJ007421-1|CAB65124.1| 1272|Homo sapiens spalt-like zinc finger protein protein. Length = 1272 Score = 29.1 bits (62), Expect = 5.8 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +1 Query: 253 LIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKE 357 L H + FKC+IC + T L +H Q HKE Sbjct: 411 LRSHTGERPFKCNICGNRFSTKGNLKVH-FQRHKE 444 >AF347021-1|AAK18311.1| 1300|Homo sapiens C2H2 zinc finger protein protein. Length = 1300 Score = 29.1 bits (62), Expect = 5.8 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +1 Query: 253 LIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKE 357 L H + FKC+IC + T L +H Q HKE Sbjct: 439 LRSHTGERPFKCNICGNRFSTKGNLKVH-FQRHKE 472 >AF272897-1|AAF78077.1| 630|Homo sapiens PR-domain zinc finger protein 5 protein. Length = 630 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +1 Query: 235 FDDEKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHK 354 F ++ L+ H + FKCH C L++H VH+ Sbjct: 417 FSLQRHLLIHNSERTFKCHHCDATFKRKDTLNVHVQVVHE 456 >AF187989-1|AAF04105.1| 482|Homo sapiens zinc finger protein ZNF223 protein. Length = 482 Score = 29.1 bits (62), Expect = 5.8 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 H K FKC IC K L+ HCM VH Sbjct: 282 HTGEKPFKCEICGKSFCLRSSLNRHCM-VH 310 >AF187988-1|AAF04104.1| 451|Homo sapiens zinc finger protein ZNF222 protein. Length = 451 Score = 29.1 bits (62), Expect = 5.8 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 H K FKC IC K L+ HCM VH Sbjct: 251 HTGEKPFKCEICGKSFCLRSSLNRHCM-VH 279 >AC067968-2|AAF66075.1| 451|Homo sapiens Zinc finger protein 222 protein. Length = 451 Score = 29.1 bits (62), Expect = 5.8 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIHCMQVH 351 H K FKC IC K L+ HCM VH Sbjct: 251 HTGEKPFKCEICGKSFCLRSSLNRHCM-VH 279 >BC132818-1|AAI32819.1| 909|Homo sapiens zinc finger and BTB domain containing 41 protein. Length = 909 Score = 28.7 bits (61), Expect = 7.7 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIH 336 H K F+C ICH++ T L++H Sbjct: 383 HTGEKPFECDICHQRYSTKSNLTVH 407 >BC017234-1|AAH17234.1| 517|Homo sapiens MBD2-interacting zinc finger protein. Length = 517 Score = 28.7 bits (61), Expect = 7.7 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 280 FKCHICHKKLYTGPGLSIHCMQVHK 354 +KCH+C K G L++H + H+ Sbjct: 345 YKCHVCDKCFTRGNNLTVHLRKKHQ 369 >BC012856-1|AAH12856.1| 517|Homo sapiens MBD2-interacting zinc finger protein. Length = 517 Score = 28.7 bits (61), Expect = 7.7 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 280 FKCHICHKKLYTGPGLSIHCMQVHK 354 +KCH+C K G L++H + H+ Sbjct: 345 YKCHVCDKCFTRGNNLTVHLRKKHQ 369 >BC001945-1|AAH01945.1| 517|Homo sapiens MBD2-interacting zinc finger protein. Length = 517 Score = 28.7 bits (61), Expect = 7.7 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 280 FKCHICHKKLYTGPGLSIHCMQVHK 354 +KCH+C K G L++H + H+ Sbjct: 345 YKCHVCDKCFTRGNNLTVHLRKKHQ 369 >BC001073-1|AAH01073.1| 517|Homo sapiens MBD2-interacting zinc finger protein. Length = 517 Score = 28.7 bits (61), Expect = 7.7 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 280 FKCHICHKKLYTGPGLSIHCMQVHK 354 +KCH+C K G L++H + H+ Sbjct: 345 YKCHVCDKCFTRGNNLTVHLRKKHQ 369 >AY163816-1|AAN71742.2| 752|Homo sapiens FRBZ1 protein. Length = 752 Score = 28.7 bits (61), Expect = 7.7 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIH 336 H K F+C ICH++ T L++H Sbjct: 383 HTGEKPFECDICHQRYSTKSNLTVH 407 >AL627208-1|CAI14333.1| 909|Homo sapiens zinc finger and BTB domain containing 41 protein. Length = 909 Score = 28.7 bits (61), Expect = 7.7 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIH 336 H K F+C ICH++ T L++H Sbjct: 383 HTGEKPFECDICHQRYSTKSNLTVH 407 >AL356315-1|CAI13461.1| 909|Homo sapiens zinc finger and BTB domain containing 41 protein. Length = 909 Score = 28.7 bits (61), Expect = 7.7 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIH 336 H K F+C ICH++ T L++H Sbjct: 383 HTGEKPFECDICHQRYSTKSNLTVH 407 >AK223368-1|BAD97088.1| 268|Homo sapiens snail 2 variant protein. Length = 268 Score = 28.7 bits (61), Expect = 7.7 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +1 Query: 268 KAKHFKCHICHKKLYTGPGLSIHCMQVHKEA 360 +AK F+C++C+K T GL+ H Q+H +A Sbjct: 124 EAKKFQCNLCNKTYSTFSGLAKH-KQLHCDA 153 >AK128549-1|BAC87496.1| 627|Homo sapiens protein ( Homo sapiens cDNA FLJ46708 fis, clone TRACH3015951, weakly similar to Zinc finger protein 151. ). Length = 627 Score = 28.7 bits (61), Expect = 7.7 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +1 Query: 262 HQKAKHFKCHICHKKLYTGPGLSIH 336 H K F+C ICH++ T L++H Sbjct: 383 HTGEKPFECDICHQRYSTKSNLTVH 407 >AC007228-2|AAD23607.1| 599|Homo sapiens BC37295_1 protein. Length = 599 Score = 28.7 bits (61), Expect = 7.7 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 4/43 (9%) Frame = +1 Query: 235 FDDEKILIQHQKA----KHFKCHICHKKLYTGPGLSIHCMQVH 351 F D LIQH++ + +KC++C K G L++H ++H Sbjct: 288 FTDHIGLIQHKRTHTGERPYKCNVCGKAFSHGSSLTVH-QRIH 329 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 48,595,417 Number of Sequences: 237096 Number of extensions: 822857 Number of successful extensions: 4759 Number of sequences better than 10.0: 86 Number of HSP's better than 10.0 without gapping: 3091 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4759 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 2928276690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -