BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P05_F_A10 (402 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g30970.1 68414.m03792 zinc finger (C2H2 type) family protein ... 88 2e-18 At3g16300.1 68416.m02057 integral membrane family protein contai... 30 0.66 At2g37430.1 68415.m04590 zinc finger (C2H2 type) family protein ... 29 0.88 At1g49900.1 68414.m05596 zinc finger (C2H2 type) family protein ... 27 3.5 At5g06650.1 68418.m00751 zinc finger (C2H2 type) family protein ... 27 4.7 At2g32920.1 68415.m04036 thioredoxin family protein similar to S... 27 4.7 At1g01780.1 68414.m00097 LIM domain-containing protein similar t... 27 6.2 At3g10000.1 68416.m01200 DNA-binding protein-related similar to ... 26 8.2 >At1g30970.1 68414.m03792 zinc finger (C2H2 type) family protein contains Pfam domain PF00096: Zinc finger, C2H2 type Length = 367 Score = 88.2 bits (209), Expect = 2e-18 Identities = 36/55 (65%), Positives = 43/55 (78%) Frame = +1 Query: 235 FDDEKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAIDXVPNSLPNRSN 399 FDDEKIL+QHQKAKHFKCH+CHKKL T G+ IH +QVHKE + VPN+ R + Sbjct: 21 FDDEKILVQHQKAKHFKCHVCHKKLSTASGMVIHVLQVHKENVTKVPNAKDGRDS 75 Score = 30.7 bits (66), Expect = 0.38 Identities = 11/18 (61%), Positives = 16/18 (88%), Gaps = 1/18 (5%) Frame = +3 Query: 177 MGRKKKKAS-KPWCWYCN 227 MG+KKK+A+ K WC+YC+ Sbjct: 1 MGKKKKRATEKVWCYYCD 18 >At3g16300.1 68416.m02057 integral membrane family protein contains TIGRFAM TIGR01569 : plant integral membrane protein TIGR01569; contains Pfam PF04535 : Domain of unknown function (DUF588); At2g38480, At1g45222 and others share this domain structure; distantly related to GP|14030504 salicylic acid-induced fragment 1 protein {Gossypium hirsutum} Length = 212 Score = 29.9 bits (64), Expect = 0.66 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 3/58 (5%) Frame = -1 Query: 366 VYGFFMYLHAVYGQSRSCVQLFVTN---VTFKMLRFLMLDENLFVVKLPCYNTSTKVW 202 +YGF LHAV+ S S + L V + V + +++ L++ + K P T T+ W Sbjct: 77 LYGFEFQLHAVWSLSDSLIYLVVVSSATVLYSLIQ-LIISGTRLMRKSPVIPTRTQAW 133 >At2g37430.1 68415.m04590 zinc finger (C2H2 type) family protein (ZAT11) contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 178 Score = 29.5 bits (63), Expect = 0.88 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 241 DEKILIQHQKAKHF-KCHICHKKLYTGPGLSIHCMQVHKEAIDXVPN 378 D K L K HF KC IC + TG L H M+ H+ ++ P+ Sbjct: 80 DVKHLSNDYKGNHFHKCSICSQSFGTGQALGGH-MRRHRSSMTVEPS 125 >At1g49900.1 68414.m05596 zinc finger (C2H2 type) family protein contains Pfam profile: PF00096 zinc finger, C2H2 type Length = 917 Score = 27.5 bits (58), Expect = 3.5 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 274 KHFKCHICHKKLYTGPGLSIHCMQVHKEAI 363 K KC ICH++ TG L H ++H E + Sbjct: 796 KIHKCSICHREFSTGQSLGGH-KRLHYEGV 824 >At5g06650.1 68418.m00751 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 191 Score = 27.1 bits (57), Expect = 4.7 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 Query: 268 KAKHFKCHICHKKLYTGPGLSIHCMQVHK 354 K K FKCH C + T L H HK Sbjct: 51 KEKRFKCHYCFRNFPTSQALGGH-QNAHK 78 >At2g32920.1 68415.m04036 thioredoxin family protein similar to SP|Q15084 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Homo sapiens}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 27.1 bits (57), Expect = 4.7 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -1 Query: 363 YGFFMYLHAVYGQSRSCVQLFVTNVTFKML 274 +GFF A+YG S VQL +N K+L Sbjct: 16 FGFFDLSSALYGSSSPVVQLTASNFKSKVL 45 >At1g01780.1 68414.m00097 LIM domain-containing protein similar to PGPS/D1 [Petunia x hybrida] GI:4105772, LIM domain protein PLIM1 [Nicotiana tabacum] GI:5932418; contains Pfam profile PF00412: LIM domain Length = 205 Score = 26.6 bits (56), Expect = 6.2 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +1 Query: 283 KCHICHKKLYTGPGLSIHCMQVHK 354 KC++C K +Y LSI M HK Sbjct: 9 KCNVCDKTVYVVDMLSIEGMPYHK 32 >At3g10000.1 68416.m01200 DNA-binding protein-related similar to GT-2 factor [Arabidopsis thaliana GI:416490 Length = 496 Score = 26.2 bits (55), Expect = 8.2 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -1 Query: 363 YGFFMYLHAVYGQSRSCVQLFVTNVTFKMLRFL 265 Y FF L A+YG+S+ V + N F M L Sbjct: 181 YRFFRQLEAIYGESKDSVSCY-NNTQFIMTNAL 212 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,433,283 Number of Sequences: 28952 Number of extensions: 123426 Number of successful extensions: 327 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 321 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 327 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 585758608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -