BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_P24 (650 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13064| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_53609| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_31092| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_38143| Best HMM Match : Neuromodulin (HMM E-Value=6.4) 28 5.7 >SB_13064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 488 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/57 (28%), Positives = 25/57 (43%), Gaps = 2/57 (3%) Frame = +1 Query: 70 NWAALAERVPAEQKAHLAAFKIKSDNYLRRVLANPPEPPKINW--AVYKQAVPIPGM 234 NW EQ+ +L F+ + Y R + PP+ + W Y Q + IPG+ Sbjct: 174 NWMGFVNCARNEQEQNLEVFQYGGNIYYRAIKDVPPDQELLVWYGGTYMQFLGIPGI 230 >SB_53609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 29.9 bits (64), Expect = 1.9 Identities = 17/43 (39%), Positives = 24/43 (55%) Frame = +1 Query: 277 YPADTQTALVESQWNQVKNAIDAFIQESNANIASYQKEINATK 405 + D LVES W +V + ID E +AN + Q+EI+ TK Sbjct: 31 FSTDYVENLVESFWTRVDDKIDKAFHERDAN-KTTQEEIHQTK 72 >SB_31092| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1032 Score = 28.3 bits (60), Expect = 5.7 Identities = 28/108 (25%), Positives = 49/108 (45%), Gaps = 2/108 (1%) Frame = +1 Query: 76 AALAERVPAEQ--KAHLAAFKIKSDNYLRRVLANPPEPPKINWAVYKQAVPIPGMVDTFQ 249 + +AE V ++Q KA + + +R +LA E ++ A VP+ G + Sbjct: 738 STVAEPVDSKQDFKAEPDETPLPDPSTMRELLALADE---VSTAAEGSTVPV-GSKQVSE 793 Query: 250 KQYEALKIPYPADTQTALVESQWNQVKNAIDAFIQESNANIASYQKEI 393 E +P P+ Q L S +V +A+++ SNAN Y +E+ Sbjct: 794 AAQEEAPLPDPSTMQDIL--SLVGEVTSAVESDDSSSNANCVEYIEEV 839 >SB_38143| Best HMM Match : Neuromodulin (HMM E-Value=6.4) Length = 217 Score = 28.3 bits (60), Expect = 5.7 Identities = 28/108 (25%), Positives = 49/108 (45%), Gaps = 2/108 (1%) Frame = +1 Query: 76 AALAERVPAEQ--KAHLAAFKIKSDNYLRRVLANPPEPPKINWAVYKQAVPIPGMVDTFQ 249 + +AE V ++Q KA + + +R +LA E ++ A VP+ G + Sbjct: 94 STVAEPVDSKQDFKAEPDETPLPDPSTMRELLALADE---VSTAAEGSTVPV-GSKQVSE 149 Query: 250 KQYEALKIPYPADTQTALVESQWNQVKNAIDAFIQESNANIASYQKEI 393 E +P P+ Q L S +V +A+++ SNAN Y +E+ Sbjct: 150 AAQEEAPLPDPSTMQDIL--SLVGEVTSAVESDDSSSNANCVEYIEEV 195 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,833,631 Number of Sequences: 59808 Number of extensions: 466685 Number of successful extensions: 1432 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1304 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1430 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -