BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_P22 (506 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC576.09 |rps20||40S ribosomal protein S20|Schizosaccharomyces... 181 6e-47 SPBC211.01 |rsm10|SPBC23E6.11|mitochondrial ribosomal protein su... 29 0.30 SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase comple... 28 0.92 SPBC649.05 |cut12|stf1|spindle pole body protein Cut12 |Schizosa... 27 1.2 SPAC959.09c |apc5|SPAP32A8.01c|anaphase-promoting complex subuni... 25 8.6 SPBP19A11.04c |mor2|cps12|morphogenesis protein Mor2|Schizosacch... 25 8.6 SPBC31F10.10c |||zf-MYND type zinc finger protein|Schizosaccharo... 25 8.6 SPAC23C4.19 |spt5||transcription elongation factor Spt5|Schizosa... 25 8.6 >SPCC576.09 |rps20||40S ribosomal protein S20|Schizosaccharomyces pombe|chr 3|||Manual Length = 118 Score = 181 bits (440), Expect = 6e-47 Identities = 85/110 (77%), Positives = 100/110 (90%) Frame = +2 Query: 137 EKPQAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRK 316 +K Q S +HRIRITLTSRNVR+LEKVC+DL+N AK ++LRVKGPVR+PTKIL+ITTRK Sbjct: 8 QKEQQIPSTVHRIRITLTSRNVRNLEKVCSDLVNRAKDKQLRVKGPVRLPTKILKITTRK 67 Query: 317 TPCGEGSKTWDRFQMXIHKRVIDLHSPSEIVKQITSINIEPGVQVEVTIA 466 TP GEGSKTW+ ++M IHKR+IDLHSPSEIVKQITSI+IEPGV+VEVTIA Sbjct: 68 TPNGEGSKTWETYEMRIHKRLIDLHSPSEIVKQITSIHIEPGVEVEVTIA 117 >SPBC211.01 |rsm10|SPBC23E6.11|mitochondrial ribosomal protein subunit S10|Schizosaccharomyces pombe|chr 2|||Manual Length = 224 Score = 29.5 bits (63), Expect = 0.30 Identities = 15/51 (29%), Positives = 28/51 (54%) Frame = +2 Query: 254 KLRVKGPVRMPTKILRITTRKTPCGEGSKTWDRFQMXIHKRVIDLHSPSEI 406 K+ +KGP +P K+ T ++P S + + F+ H R+I L+S + + Sbjct: 92 KIPIKGPRPLPNKVESWTLLRSPFIHKS-SQENFERITHSRLIQLYSVNPV 141 >SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase complex subunit Pst1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1522 Score = 27.9 bits (59), Expect = 0.92 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = +2 Query: 119 VSGKDIEKPQAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVK 268 +S IEKP+A SPIH + +R L+ V GA++ + VK Sbjct: 891 LSSSLIEKPRASSSPIHH----ANNNGLRLLKDVLKKTYRGARENRSSVK 936 >SPBC649.05 |cut12|stf1|spindle pole body protein Cut12 |Schizosaccharomyces pombe|chr 2|||Manual Length = 548 Score = 27.5 bits (58), Expect = 1.2 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +2 Query: 110 AAVVSGKDIEKPQAEVSPIHRIRITLTSRNVRS 208 A V + D+EKPQ +V+ R+ L S N R+ Sbjct: 491 ANVTTSADVEKPQVKVATSSRVDYDLKSPNQRT 523 >SPAC959.09c |apc5|SPAP32A8.01c|anaphase-promoting complex subunit Apc5 |Schizosaccharomyces pombe|chr 1|||Manual Length = 737 Score = 24.6 bits (51), Expect = 8.6 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 390 CRSITLLWIXI*KRSQVFEPSPQ 322 C + L W+ KRSQ PSP+ Sbjct: 331 CLNFALAWMFEFKRSQYSNPSPE 353 >SPBP19A11.04c |mor2|cps12|morphogenesis protein Mor2|Schizosaccharomyces pombe|chr 2|||Manual Length = 2196 Score = 24.6 bits (51), Expect = 8.6 Identities = 16/52 (30%), Positives = 22/52 (42%) Frame = -1 Query: 401 QRESVGRSLSCGXSSENDPRSLNLHHKEFYGW*YAGSWLACGLGPLHAASVS 246 +R SV + SC S N P S+ + + W LG LH +S S Sbjct: 626 KRNSVLSNKSCASSESNTPASVKQDYDDIQSWTIIEE--IQSLGVLHLSSPS 675 >SPBC31F10.10c |||zf-MYND type zinc finger protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 574 Score = 24.6 bits (51), Expect = 8.6 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +2 Query: 311 RKTPCGEGSKTWDRFQM 361 R +P GSKTW+ FQ+ Sbjct: 427 RMSPLRSGSKTWNIFQL 443 >SPAC23C4.19 |spt5||transcription elongation factor Spt5|Schizosaccharomyces pombe|chr 1|||Manual Length = 990 Score = 24.6 bits (51), Expect = 8.6 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +1 Query: 265 KGPSPHANQDPAYHHP*NSLW*RFKDLGSFSDXNPQESD 381 K P+ +ANQ P + N+ W + G FS+ N D Sbjct: 916 KTPAWNANQTPMVANGTNTSWGQTPAYGGFSETNWDTED 954 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,087,695 Number of Sequences: 5004 Number of extensions: 42183 Number of successful extensions: 107 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 107 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 202220600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -