BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_P20 (652 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 23 8.4 AJ439060-6|CAD27757.1| 297|Anopheles gambiae hypothetical prote... 23 8.4 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 23.0 bits (47), Expect = 8.4 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +1 Query: 31 LLHCRHLTLNHSSQKF 78 LL C H+T H SQK+ Sbjct: 715 LLVCGHVTKTHVSQKY 730 >AJ439060-6|CAD27757.1| 297|Anopheles gambiae hypothetical protein protein. Length = 297 Score = 23.0 bits (47), Expect = 8.4 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +3 Query: 255 ITNIEDHIVIKAEPTAYYISKFITEAEEQLI 347 +TNIE H + E ++I K I +A+ ++ Sbjct: 1 MTNIEQHHDVVKESFFHFIRKHIPKADLSIV 31 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 697,546 Number of Sequences: 2352 Number of extensions: 14052 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -