BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_P20 (652 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor p... 22 4.5 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 4.5 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 22 5.9 X91509-1|CAA62809.1| 103|Apis mellifera histone H4 protein. 21 7.8 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 7.8 >DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor protein. Length = 157 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -3 Query: 128 TTVHSIHSI 102 TT+HSIHSI Sbjct: 107 TTIHSIHSI 115 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 22.2 bits (45), Expect = 4.5 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +3 Query: 480 LERIHKLNVMCGRRPNHVLVNEYTPGQGIM 569 L R+ + + G N + EY PG G++ Sbjct: 397 LIRVENIIDLEGAPQNFYYIEEYLPGNGVI 426 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 21.8 bits (44), Expect = 5.9 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 487 LSRYRSNQVGIVSAIIPLLCGTPP 416 L++YR N V + + LL PP Sbjct: 508 LNKYRGNGVSLKGETVGLLNALPP 531 >X91509-1|CAA62809.1| 103|Apis mellifera histone H4 protein. Length = 103 Score = 21.4 bits (43), Expect = 7.8 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = +3 Query: 354 NIYAAPKPKWTQLSNRXLQNWGGVPHNKGMIAETIPTWLDLYLERI 491 NI KP +L+ R GGV G+I E L ++LE + Sbjct: 26 NIQGITKPAIRRLARR-----GGVKRISGLIYEETRGVLKVFLENV 66 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +2 Query: 596 PDHNNNISGLAHSL 637 PDHN N S +A +L Sbjct: 677 PDHNGNYSCVARNL 690 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,180 Number of Sequences: 438 Number of extensions: 3822 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -