BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_P18 (620 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0665 - 30720842-30721003,30721290-30721448,30721555-307216... 28 6.9 06_01_0600 + 4332886-4332896,4332968-4333067,4333588-4333664,433... 27 9.1 >02_05_0665 - 30720842-30721003,30721290-30721448,30721555-30721687, 30722042-30722227,30722377-30722906 Length = 389 Score = 27.9 bits (59), Expect = 6.9 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = -3 Query: 234 CGTCLVSFPANAKVPFLDCNQLSVLYYYRKDLRIWDRCWICSSNIL 97 C CL S+ A++ L CN K LR+ C +C NIL Sbjct: 338 CCICLSSYEDGAELSALPCNHHFHWTCITKWLRMHATCPLCKYNIL 383 >06_01_0600 + 4332886-4332896,4332968-4333067,4333588-4333664, 4333774-4333835,4334016-4334134,4334237-4334404, 4335004-4335123 Length = 218 Score = 27.5 bits (58), Expect = 9.1 Identities = 6/20 (30%), Positives = 17/20 (85%) Frame = -1 Query: 197 KSLFLIAISYRYCTIIERIC 138 K +++ +S+++C+++ER+C Sbjct: 13 KHVYIDRLSFKFCSVVERVC 32 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,599,377 Number of Sequences: 37544 Number of extensions: 253304 Number of successful extensions: 657 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 645 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 657 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1502076244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -