BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_P06 (652 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 54 2e-09 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 24 0.21 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 23 1.9 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 23 2.6 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 23 2.6 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 23 3.4 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 22 4.5 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 22 4.5 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 53.6 bits (123), Expect = 2e-09 Identities = 38/119 (31%), Positives = 61/119 (51%), Gaps = 11/119 (9%) Frame = +1 Query: 307 TFTSMLLSEFTLXGLISSGFQKPSPIQLHGVPLGKCGFDLLLEAKSGTGKTVVFSIIALE 486 +F + L L + SG++KP+P+Q H +P+ G DL+ A++G+GKT F++ + Sbjct: 197 SFEAAGLRNIVLDNIKKSGYKKPTPVQKHALPIIMNGRDLMACAQTGSGKTAAFAVPIIN 256 Query: 487 KLNLNNGL-----------QVMILTPTREIAAQICDVIKQIGSHHKGLNVEXVMGGLSV 630 L L + QV+I++PTRE+ QI I + S + L GG SV Sbjct: 257 TL-LERSVDLVVTSTYCEPQVVIVSPTRELTIQIWQQIVKF-SLNSILKTVVAYGGTSV 313 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 23.8 bits (49), Expect(2) = 0.21 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 Query: 411 MWFRFVTRSKVWNW 452 M+F VTR VW W Sbjct: 447 MFFNMVTRDSVWCW 460 Score = 21.0 bits (42), Expect(2) = 0.21 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +3 Query: 306 YVHFHASFRIYTXRIDIIGVPKTISNSTSW 395 + H +SFR + I+G KT +T + Sbjct: 392 FFHPMSSFREFAVSTSILGDKKTAEENTDY 421 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 23.4 bits (48), Expect = 1.9 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +1 Query: 148 EKSQRTLAEPSNISESN 198 E S+ AEPSNI ESN Sbjct: 555 ETSKGINAEPSNIEESN 571 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/41 (21%), Positives = 20/41 (48%) Frame = -3 Query: 575 ICLITSHICAAISRVGVKIITCKPLLRFSFSNAIIENTTVF 453 I + +C+ ++ ++T +P L +F N + TV+ Sbjct: 234 ITRVIPQVCSGNCKLNDILLTVRPHLELTFENILSHINTVY 274 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/41 (21%), Positives = 20/41 (48%) Frame = -3 Query: 575 ICLITSHICAAISRVGVKIITCKPLLRFSFSNAIIENTTVF 453 I + +C+ ++ ++T +P L +F N + TV+ Sbjct: 234 ITRVIPQVCSGNCKLNDILLTVRPHLELTFENILSHINTVY 274 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 22.6 bits (46), Expect = 3.4 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +3 Query: 585 PQGSECRXCNGRIIC 629 P G EC+ CN + C Sbjct: 432 PIGCECKTCNSKTKC 446 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 22.2 bits (45), Expect = 4.5 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +3 Query: 468 FYNSIRKTKS**WFASNDLDTYTRNSST 551 F S RKT +F L TY N+ST Sbjct: 272 FVGSCRKTDQILYFIRGCLQTYLINAST 299 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 22.2 bits (45), Expect = 4.5 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +3 Query: 468 FYNSIRKTKS**WFASNDLDTYTRNSST 551 F S RKT +F L TY N+ST Sbjct: 310 FVGSCRKTDQILYFIRGCLQTYLINAST 337 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,819 Number of Sequences: 438 Number of extensions: 3086 Number of successful extensions: 13 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -