BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_P05 (610 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0459 + 3546101-3548771,3548871-3549238 28 5.0 07_03_0697 + 20759176-20759817,20760592-20760708,20761422-207616... 28 6.7 >11_01_0459 + 3546101-3548771,3548871-3549238 Length = 1012 Score = 28.3 bits (60), Expect = 5.0 Identities = 18/51 (35%), Positives = 26/51 (50%) Frame = -3 Query: 482 ISNNLTIIRLINKFPMQKFVLALATINVNRSVHSVLM*IWXFSALN*AFNN 330 ++ N + +LIN FP + VL LA+ N ++ S I LN A NN Sbjct: 152 LNGNHLVGQLINNFPPKLQVLTLASNNFTGTIPSSFANITELRNLNFASNN 202 >07_03_0697 + 20759176-20759817,20760592-20760708,20761422-20761696, 20761906-20762068,20762293-20762421,20762989-20763713, 20763853-20764081 Length = 759 Score = 27.9 bits (59), Expect = 6.7 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +1 Query: 283 LRTYLLNKVEYLFTPVLLNA*FKALNXHIYIKTEWTDL 396 LRTY LN++ Y + V+ ++ A H+Y+ + T+L Sbjct: 336 LRTYELNRLRYYYAVVVCDS--SATANHLYMNLDGTEL 371 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,269,736 Number of Sequences: 37544 Number of extensions: 259572 Number of successful extensions: 492 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 480 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 492 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1454766756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -