BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_P05 (610 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein ... 25 1.9 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 23 7.7 >CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein protein. Length = 615 Score = 25.0 bits (52), Expect = 1.9 Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Frame = -3 Query: 245 NPVVRIEQCKVVRV---VRRKILQEFYHRHSEKCAIYIRYTSVPNDN 114 NPVVR+++ +VR+ VR I F + R VP N Sbjct: 446 NPVVRVQKTVLVRLDRSVRHSIADRFVTLSGTAAGTHRRQLGVPTKN 492 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 23.0 bits (47), Expect = 7.7 Identities = 13/31 (41%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +1 Query: 517 SVXCFVLGIFSPSSCKRVKTCRCE--CVMNL 603 +V F+ FS RV TC CE C NL Sbjct: 54 NVLTFISSFFSLFQTARVLTCYCEGHCPGNL 84 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 622,408 Number of Sequences: 2352 Number of extensions: 13056 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59291487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -