BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_P04 (441 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_07_0070 + 27479654-27479672,27479864-27479922,27480339-274803... 129 8e-31 01_06_0260 - 27959188-27959251,27959342-27959424,27960220-279603... 128 2e-30 07_03_0481 - 18572206-18574314,18574591-18575185,18575304-185753... 28 2.9 12_02_0648 + 21490202-21490296,21490547-21490634,21491216-214912... 27 5.1 09_06_0303 - 22149214-22149474,22150099-22150236,22150856-221511... 27 5.1 02_03_0063 + 14600318-14600322,14600936-14601011,14601615-14601776 27 8.8 >05_07_0070 + 27479654-27479672,27479864-27479922,27480339-27480378, 27480477-27480565,27481065-27481147,27481219-27481282 Length = 117 Score = 129 bits (312), Expect = 8e-31 Identities = 56/89 (62%), Positives = 68/89 (76%) Frame = +2 Query: 53 KMAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKR 232 ++ KRTKK GI GKYGTRYGASLRK +KKMEV+QH+KY C FCGK A+KR VGIW CK Sbjct: 25 ELTKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKFAVKRKAVGIWGCKD 84 Query: 233 CKRTVXGGAWVFSTTAASSCRSAVRRLRE 319 C + GGA+ +T +A + RS +RRLRE Sbjct: 85 CGKVKAGGAYTMNTASAVTVRSTIRRLRE 113 >01_06_0260 - 27959188-27959251,27959342-27959424,27960220-27960308, 27960388-27960427,27960938-27960981,27961240-27961288 Length = 122 Score = 128 bits (309), Expect = 2e-30 Identities = 56/86 (65%), Positives = 66/86 (76%) Frame = +2 Query: 62 KRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCKR 241 KRTKK GI GKYGTRYGASLRK +KKMEV+QH+KY C FCGK A+KR VGIW CK C + Sbjct: 33 KRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKFAVKRKAVGIWGCKDCGK 92 Query: 242 TVXGGAWVFSTTAASSCRSAVRRLRE 319 GGA+ +T +A + RS +RRLRE Sbjct: 93 VKAGGAYTMNTASAVTVRSTIRRLRE 118 >07_03_0481 - 18572206-18574314,18574591-18575185,18575304-18575371, 18577344-18577458,18578179-18578333,18578673-18580621, 18580691-18581372,18581550-18581621,18582558-18583199, 18583301-18583402,18585011-18585100 Length = 2192 Score = 28.3 bits (60), Expect = 2.9 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = +2 Query: 179 CGKDAMKRSCVGIWSCKRCKRTVXGGAWVFSTTAASSCRSAVRRLR 316 C +KR+ G W C RC+ + + A +S R RR+R Sbjct: 58 CLNPPLKRAPPGNWQCPRCRTKKVSLKLLDNADADTSKRERTRRMR 103 >12_02_0648 + 21490202-21490296,21490547-21490634,21491216-21491260, 21491355-21491387,21491480-21491557,21491647-21491690, 21491765-21491805,21492102-21492184,21492261-21492352, 21492468-21492537,21492838-21492876,21493670-21493687, 21494586-21494713,21495235-21495358,21495585-21495716, 21496092-21496223,21496582-21496665 Length = 441 Score = 27.5 bits (58), Expect = 5.1 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 143 EVTQHAKYTCSFCGKDAM 196 E+ +H KYTC C K A+ Sbjct: 194 EMVEHNKYTCPICSKTAL 211 >09_06_0303 - 22149214-22149474,22150099-22150236,22150856-22151100, 22151344-22151809 Length = 369 Score = 27.5 bits (58), Expect = 5.1 Identities = 22/75 (29%), Positives = 27/75 (36%), Gaps = 1/75 (1%) Frame = +2 Query: 26 STFVSERFTKMAKRTKKVG-ITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKR 202 S + RF ++V K G Y L K AKYT G A R Sbjct: 60 SDMMKSRFEAFKANARQVNEFNKKEGMSYTLGLNKFSDMSYEEFAAKYTGGMPGSIADDR 119 Query: 203 SCVGIWSCKRCKRTV 247 S G SCK ++ V Sbjct: 120 SSAGAVSCKLREKNV 134 >02_03_0063 + 14600318-14600322,14600936-14601011,14601615-14601776 Length = 80 Score = 26.6 bits (56), Expect = 8.8 Identities = 12/49 (24%), Positives = 25/49 (51%) Frame = +2 Query: 17 FSLSTFVSERFTKMAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAK 163 + L ++ + + K + G+T + +RY LR+ ++K+EV K Sbjct: 11 YELEVYMLTIYLLLHKNQVRHGVTARRTSRYYVVLRRELRKLEVVGKVK 59 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,898,222 Number of Sequences: 37544 Number of extensions: 195441 Number of successful extensions: 495 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 486 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 495 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 835800280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -