BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_P04 (441 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g60245.1 68416.m06733 60S ribosomal protein L37a (RPL37aC) 131 2e-31 At3g10950.1 68416.m01320 60S ribosomal protein L37a (RPL37aB) si... 124 3e-29 At2g32770.3 68415.m04011 purple acid phosphatase (PAP13) identic... 30 0.60 At2g32770.2 68415.m04012 purple acid phosphatase (PAP13) identic... 30 0.60 At2g32770.1 68415.m04010 purple acid phosphatase (PAP13) identic... 30 0.60 At4g28730.1 68417.m04109 glutaredoxin family protein contains gl... 27 4.2 At4g38600.2 68417.m05463 HECT-domain-containing protein / ubiqui... 27 7.4 At4g38600.1 68417.m05464 HECT-domain-containing protein / ubiqui... 27 7.4 >At3g60245.1 68416.m06733 60S ribosomal protein L37a (RPL37aC) Length = 92 Score = 131 bits (316), Expect = 2e-31 Identities = 57/88 (64%), Positives = 68/88 (77%) Frame = +2 Query: 56 MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 235 MAKRTKKVGI GKYGTRYGAS+RK +KKMEV+QH+KY C FCGK +KR VGIW CK C Sbjct: 1 MAKRTKKVGIVGKYGTRYGASIRKQIKKMEVSQHSKYFCEFCGKYGVKRKAVGIWGCKDC 60 Query: 236 KRTVXGGAWVFSTTAASSCRSAVRRLRE 319 + GGA+ +T +A + RS +RRLRE Sbjct: 61 GKVKAGGAYTMNTASAVTVRSTIRRLRE 88 >At3g10950.1 68416.m01320 60S ribosomal protein L37a (RPL37aB) similar to putative 60S ribosomal protein L37a GB:AAD28753 [Gossypium hirsutum] Length = 92 Score = 124 bits (299), Expect = 3e-29 Identities = 55/88 (62%), Positives = 65/88 (73%) Frame = +2 Query: 56 MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 235 M KRTKK I GKYGTRYGASLRK +KKMEV+QH KY C FCGK ++KR VGIW CK C Sbjct: 1 MTKRTKKARIVGKYGTRYGASLRKQIKKMEVSQHNKYFCEFCGKYSVKRKVVGIWGCKDC 60 Query: 236 KRTVXGGAWVFSTTAASSCRSAVRRLRE 319 + GGA+ +T +A + RS +RRLRE Sbjct: 61 GKVKAGGAYTMNTASAVTVRSTIRRLRE 88 >At2g32770.3 68415.m04011 purple acid phosphatase (PAP13) identical to purple acid phosphatase (PAP13) [Arabidopsis thaliana] GI:20257489; contains Pfam profile PF00149: Ser/Thr protein phosphatase Length = 545 Score = 30.3 bits (65), Expect = 0.60 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 40 GEVYQNGQTYQKGWNYW 90 G Y +G+TYQ W+YW Sbjct: 261 GSCYSSGETYQPRWDYW 277 >At2g32770.2 68415.m04012 purple acid phosphatase (PAP13) identical to purple acid phosphatase (PAP13) [Arabidopsis thaliana] GI:20257489; contains Pfam profile PF00149: Ser/Thr protein phosphatase Length = 428 Score = 30.3 bits (65), Expect = 0.60 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 40 GEVYQNGQTYQKGWNYW 90 G Y +G+TYQ W+YW Sbjct: 180 GSCYSSGETYQPRWDYW 196 >At2g32770.1 68415.m04010 purple acid phosphatase (PAP13) identical to purple acid phosphatase (PAP13) [Arabidopsis thaliana] GI:20257489; contains Pfam profile PF00149: Ser/Thr protein phosphatase Length = 516 Score = 30.3 bits (65), Expect = 0.60 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 40 GEVYQNGQTYQKGWNYW 90 G Y +G+TYQ W+YW Sbjct: 261 GSCYSSGETYQPRWDYW 277 >At4g28730.1 68417.m04109 glutaredoxin family protein contains glutaredoxin domain, Pfam:PF00462 Length = 174 Score = 27.5 bits (58), Expect = 4.2 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +2 Query: 86 TGKYGTRYGASLRKMVKKMEVTQHAKYTCSFC 181 + +G+R S+RK V + V ++K CS+C Sbjct: 62 SSSFGSRMEESIRKTVTENTVVIYSKTWCSYC 93 >At4g38600.2 68417.m05463 HECT-domain-containing protein / ubiquitin-transferase family protein similar to SP|Q14669Thyroid receptor interacting protein 12 (TRIP12) {Homo sapiens}; contains Pfam profile PF00632: HECT-domain (ubiquitin-transferase) Length = 1794 Score = 26.6 bits (56), Expect = 7.4 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -1 Query: 261 QAPPXTVLLHRLQDQMPTQERF 196 + PP TVL+ +LQ+ + + ERF Sbjct: 802 KVPPMTVLIQKLQNALSSLERF 823 >At4g38600.1 68417.m05464 HECT-domain-containing protein / ubiquitin-transferase family protein similar to SP|Q14669Thyroid receptor interacting protein 12 (TRIP12) {Homo sapiens}; contains Pfam profile PF00632: HECT-domain (ubiquitin-transferase) Length = 1888 Score = 26.6 bits (56), Expect = 7.4 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -1 Query: 261 QAPPXTVLLHRLQDQMPTQERF 196 + PP TVL+ +LQ+ + + ERF Sbjct: 875 KVPPMTVLIQKLQNALSSLERF 896 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,040,110 Number of Sequences: 28952 Number of extensions: 159626 Number of successful extensions: 471 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 466 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 471 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 702840360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -