BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_P02 (649 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_07_0176 - 13826764-13827064,13827271-13827377,13827474-138278... 32 0.45 11_06_0247 - 21669299-21669348,21669673-21670012,21670110-216701... 29 2.4 10_08_0210 - 15874289-15875663,15878248-15879263 29 3.2 01_01_0953 - 7472173-7472178,7472216-7472311,7472370-7472462,747... 28 5.6 05_01_0155 + 1043045-1043240,1043325-1043401,1043963-1044092,104... 27 9.7 02_05_0410 + 28744716-28744841,28745361-28745965,28746151-287462... 27 9.7 >10_07_0176 - 13826764-13827064,13827271-13827377,13827474-13827836, 13827912-13828079,13828153-13828374,13828784-13829023, 13829640-13829719,13829853-13830018,13830720-13830783, 13830861-13830962,13831085-13831227,13831370-13831474, 13831551-13831706,13832125-13832241,13832315-13832392, 13832466-13832550,13833334-13833455,13833546-13833611, 13835190-13835284,13835427-13835523,13835873-13835983, 13836083-13836164,13836292-13836353,13836620-13836685, 13838002-13838232 Length = 1142 Score = 31.9 bits (69), Expect = 0.45 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +2 Query: 317 LPFTLILSLIKSSTM*WKKVTNDWLVNSLRKHSKISKGNKLNDTIW 454 L L++SLIK + WK+ ND +N+ H + +G K T W Sbjct: 131 LSLVLLVSLIKEAFEDWKRFQNDMSINN--AHVDVLQGQKWETTPW 174 >11_06_0247 - 21669299-21669348,21669673-21670012,21670110-21670199, 21670280-21670339,21670564-21670856,21671176-21671245, 21671623-21671970,21673188-21673318,21673418-21673901, 21674839-21675558 Length = 861 Score = 29.5 bits (63), Expect = 2.4 Identities = 26/97 (26%), Positives = 42/97 (43%) Frame = +1 Query: 232 EDQVKLIADSDLKNRATVPVKPPTVSETSSVYFDPLVNKVINHVMEKGNKRLARQLVEKA 411 E+Q +L A S +R PV+ PTV+ T + +K N + E ++ R + Sbjct: 490 EEQARLNAASSFSSRTEAPVE-PTVAGTLGETLE-ANSKYGNKLDENYENKMTRTVEAAR 547 Query: 412 FENIKRKQIERYHLASTPEEKAKIXLNPKDILYKAVE 522 ++ RK + LA EKA+ L + K E Sbjct: 548 HADLVRKLEWKLQLAQKKIEKAERVLGKVETALKPTE 584 >10_08_0210 - 15874289-15875663,15878248-15879263 Length = 796 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/47 (34%), Positives = 27/47 (57%) Frame = +2 Query: 131 ASIHLQEHYQNSKFEIMRRRQAFQTIIKIQYLEKKIK*NSLQIRI*R 271 +SIHL + + + + +R Q ++ YLE+ I NSL+IR+ R Sbjct: 473 SSIHLSQQVKEAVVDSLRN-SVRQNLVLNNYLEQAISKNSLRIRLVR 518 >01_01_0953 - 7472173-7472178,7472216-7472311,7472370-7472462, 7472855-7473019,7473689-7474821,7474902-7475426, 7477077-7477249,7478737-7478831,7478893-7481688 Length = 1693 Score = 28.3 bits (60), Expect = 5.6 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +1 Query: 169 IRNYAKATSFPDYYQNPIFRK 231 ++N +KA SFP+ Y+NP K Sbjct: 567 VQNLSKALSFPESYENPYLMK 587 >05_01_0155 + 1043045-1043240,1043325-1043401,1043963-1044092, 1044376-1044473,1045622-1045729,1045748-1045800, 1046876-1047080 Length = 288 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/38 (26%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -3 Query: 641 VCSNHLIAKNNDLFSVIGPG-TWYVIPPLLMGCNCNNG 531 +C + ++A N+ F +G ++PP+ C+C++G Sbjct: 191 LCGSGILACPNNKFGSLGQNKVMKLVPPVYRACSCSSG 228 >02_05_0410 + 28744716-28744841,28745361-28745965,28746151-28746270, 28746597-28746737,28748626-28749370 Length = 578 Score = 27.5 bits (58), Expect = 9.7 Identities = 19/58 (32%), Positives = 28/58 (48%) Frame = +1 Query: 121 KNSSFNSSTRTLSKLQIRNYAKATSFPDYYQNPIFRKEDQVKLIADSDLKNRATVPVK 294 KNSS NSS+ S N + + ++Q P+ + E + A + ATVPVK Sbjct: 387 KNSSSNSSSSGASSASKNNSSHSGYHHHHHQKPLVKAEPNDQSAAAT---TAATVPVK 441 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,008,388 Number of Sequences: 37544 Number of extensions: 290064 Number of successful extensions: 774 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 756 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 774 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1608522592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -