BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_O20 (647 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45284| Best HMM Match : Nucleoplasmin (HMM E-Value=8.7e-10) 41 0.001 SB_13096| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12) 28 7.5 SB_8157| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_23042| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 >SB_45284| Best HMM Match : Nucleoplasmin (HMM E-Value=8.7e-10) Length = 282 Score = 40.7 bits (91), Expect = 0.001 Identities = 31/99 (31%), Positives = 49/99 (49%), Gaps = 5/99 (5%) Frame = +3 Query: 90 EFFYGVTLSSSHQSETWDPEAKAEYPR----SNKLVIRQALLGPDAKPXELNVIQVEAMS 257 E F+G LS S + TW+PE E +KLV+ QA LG +K ++++V +M Sbjct: 7 EDFWGCVLSKSEDTVTWNPEFDGEDTLLGQIEHKLVLSQACLG--SKATGKSMVEVTSMD 64 Query: 258 LQ-EAVKLPVAVLKVGESXHVRLDIEFPDAPVTFTLVQG 371 + + + L+ G + L++ F PVTF L G Sbjct: 65 FKGDDSTHTIVSLREGATEMCALNLAF-SPPVTFKLASG 102 >SB_13096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1465 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = -2 Query: 361 RVNVTGASGNSMSRRTCXDSPTFNTATGSFTASCSDMASTC 239 RVN+T +G + RTC +P S ++ SD + TC Sbjct: 821 RVNITKCNGTNAQSRTCAFAPCPVNGAWSSWSAWSDCSKTC 861 >SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12) Length = 1392 Score = 27.9 bits (59), Expect = 7.5 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +1 Query: 94 FSMVSPFHHHISQRHGIQRQKQNTHAATSSSFVK 195 FS+ P I+ RHG+ RQK HA+ SF K Sbjct: 338 FSLHRPVED-INYRHGLGRQKLLFHASRGKSFYK 370 >SB_8157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 405 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -2 Query: 319 RTCXDSPTFNTATGSFTASCSDMASTC 239 R C D T+ TGS C D++STC Sbjct: 284 RYCYDDMTWQPITGSPRRFCLDVSSTC 310 >SB_23042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +2 Query: 437 WRKWNKKCYMXNKXMILSSRMXIMXKVNPRAKKRKCRIMPKAKLHRP 577 W KW ++C +K M+ SR K N R+++ C + ++ HRP Sbjct: 64 WDKWLERCTEESKKML--SRFEKKCKENKRSEQNFC--VARSVQHRP 106 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,163,938 Number of Sequences: 59808 Number of extensions: 318788 Number of successful extensions: 805 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 761 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 805 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1645141000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -