BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_O19 (352 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712902-1|CAN84641.1| 95|Tribolium castaneum hypothetical pro... 27 0.056 AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory recept... 23 0.91 AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 22 1.6 AM292346-1|CAL23158.2| 314|Tribolium castaneum gustatory recept... 22 1.6 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 2.1 AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 21 4.8 AM292365-1|CAL23177.1| 313|Tribolium castaneum gustatory recept... 20 6.4 AM292325-1|CAL23137.2| 309|Tribolium castaneum gustatory recept... 20 6.4 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 20 8.5 >AM712902-1|CAN84641.1| 95|Tribolium castaneum hypothetical protein protein. Length = 95 Score = 27.1 bits (57), Expect = 0.056 Identities = 18/57 (31%), Positives = 26/57 (45%) Frame = +2 Query: 173 GXNKIHKRSKIKPFVKVVNYNHLMPTRYTVDFSFEKFSAKDLKDPAKRKKLRFNTRV 343 G + +R + +P V + H+ P S K K P KRK++RF TRV Sbjct: 19 GRGQNTQRVQNQPLVIGCDEKHVSPHVIGGITSGGPIPTKSSKYPIKRKRVRFQTRV 75 >AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory receptor candidate 27 protein. Length = 346 Score = 23.0 bits (47), Expect = 0.91 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 Query: 206 KPFVKVVNYNHLMPTRY 256 K F +VN HL+ T+Y Sbjct: 83 KNFTNIVNLTHLLETQY 99 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 22.2 bits (45), Expect = 1.6 Identities = 7/18 (38%), Positives = 14/18 (77%) Frame = -3 Query: 233 YSLQPSRKALSWTSCGFY 180 +SLQ + + L +++CGF+ Sbjct: 333 FSLQLAHQKLEFSACGFF 350 >AM292346-1|CAL23158.2| 314|Tribolium castaneum gustatory receptor candidate 25 protein. Length = 314 Score = 22.2 bits (45), Expect = 1.6 Identities = 7/18 (38%), Positives = 14/18 (77%) Frame = -3 Query: 233 YSLQPSRKALSWTSCGFY 180 +SLQ + + L +++CGF+ Sbjct: 158 FSLQLAHQKLEFSACGFF 175 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 2.1 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -1 Query: 61 DPRTGHLRPALLYPASL 11 D +TGH+ P YP + Sbjct: 2520 DKQTGHVAPLYYYPGDV 2536 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 20.6 bits (41), Expect = 4.8 Identities = 13/47 (27%), Positives = 19/47 (40%) Frame = +2 Query: 143 GTPGKVHKRMGXNKIHKRSKIKPFVKVVNYNHLMPTRYTVDFSFEKF 283 GTP K N + K + V V NHL + F+F+ + Sbjct: 14 GTPPKFELPTTHNCLKKVLLLSQIVGVFPLNHLNEEPEKLHFTFKSW 60 >AM292365-1|CAL23177.1| 313|Tribolium castaneum gustatory receptor candidate 44 protein. Length = 313 Score = 20.2 bits (40), Expect = 6.4 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -1 Query: 340 SRVETQLLTFCRVFQVFCAEFF 275 +++ T L +C V VF FF Sbjct: 67 AKITTILQRYCSVLLVFLTYFF 88 >AM292325-1|CAL23137.2| 309|Tribolium castaneum gustatory receptor candidate 4 protein. Length = 309 Score = 20.2 bits (40), Expect = 6.4 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -1 Query: 340 SRVETQLLTFCRVFQVFCAEFF 275 +++ T L +C V VF FF Sbjct: 63 AKITTILQRYCSVLLVFLTYFF 84 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 19.8 bits (39), Expect = 8.5 Identities = 6/16 (37%), Positives = 9/16 (56%) Frame = -3 Query: 158 LCRGYLSIPATKACPY 111 LC GY ++ CP+ Sbjct: 74 LCSGYFTVHLLFYCPF 89 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 77,222 Number of Sequences: 336 Number of extensions: 1578 Number of successful extensions: 9 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 6981810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -