BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_O01 (640 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 21 6.6 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 21 8.7 AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 21 8.7 >AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix transcription factor protein. Length = 249 Score = 21.4 bits (43), Expect = 6.6 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -2 Query: 474 ILXHQINHLKQIQRQGSASS 415 IL + HL+ +QRQ +A S Sbjct: 80 ILEMTVKHLQNLQRQQAAMS 99 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 21.0 bits (42), Expect = 8.7 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = +3 Query: 81 GIQFKYIXNIHSILFTFW 134 G+ F+Y N+H+ FW Sbjct: 160 GMTFRYHFNVHNSGTHFW 177 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 21.0 bits (42), Expect = 8.7 Identities = 11/49 (22%), Positives = 22/49 (44%) Frame = +3 Query: 363 LDKMXREWQMHQAFQTIMMMLSPDVVFVLGDLFDEXEWTNNKXFQXYVE 509 + K+ Q+ T L+P++ ++L L+ WT+ F + E Sbjct: 96 MSKLLGNHQLVYNCHTFGRFLAPNLTYLLVALYSGYVWTDILGFGYFRE 144 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,207 Number of Sequences: 336 Number of extensions: 2790 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16501678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -