BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_N13 (497 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB208784-1|BAD92021.1| 222|Homo sapiens zinc finger protein 76 ... 32 1.3 AF199414-1|AAF86048.1| 648|Homo sapiens RNA helicase A binding ... 30 5.1 >AB208784-1|BAD92021.1| 222|Homo sapiens zinc finger protein 76 (expressed in testis) variant protein. Length = 222 Score = 31.9 bits (69), Expect = 1.3 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = -3 Query: 381 APRPCARCSASTVPKPPWPCRSRLRALPWR 292 +P P A + T PPWPC S + WR Sbjct: 162 SPTPAAPAARPTGRPPPWPCTSAVPMASWR 191 >AF199414-1|AAF86048.1| 648|Homo sapiens RNA helicase A binding protein 95 protein. Length = 648 Score = 29.9 bits (64), Expect = 5.1 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -2 Query: 142 P*RSRERRVAPSLPWARAMQAKRTTNLAAMMCCRET 35 P R R RR ++PW R +AKR A CR + Sbjct: 553 PRRRRSRRRLRAVPWTRGRRAKRQGFRRAQRACRRS 588 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 60,905,229 Number of Sequences: 237096 Number of extensions: 1050041 Number of successful extensions: 4363 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3975 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4352 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4536472160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -