BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_M14 (575 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z86090-4|CAO03487.1| 296|Homo sapiens melanin-concentrating hor... 33 0.72 Z86090-3|CAI17933.1| 422|Homo sapiens melanin-concentrating hor... 33 0.72 U71092-1|AAC14587.1| 402|Homo sapiens somatostatin receptor-lik... 33 0.72 CR456497-1|CAG30383.1| 422|Homo sapiens GPR24 protein. 33 0.72 BT006725-1|AAP35371.1| 422|Homo sapiens G protein-coupled recep... 33 0.72 BC021146-1|AAH21146.1| 422|Homo sapiens melanin-concentrating h... 33 0.72 BC001736-1|AAH01736.1| 422|Homo sapiens melanin-concentrating h... 33 0.72 AY747629-1|AAV98053.1| 296|Homo sapiens G-protein coupled recep... 33 0.72 AY745811-1|AAV98052.1| 311|Homo sapiens G-protein coupled recep... 33 0.72 AY562945-1|AAS72373.1| 422|Homo sapiens melanin-concentrating h... 33 0.72 AF490537-1|AAO14670.1| 422|Homo sapiens G protein-coupled recep... 33 0.72 AB063174-1|BAB60890.1| 422|Homo sapiens somatostatin receptor-l... 33 0.72 >Z86090-4|CAO03487.1| 296|Homo sapiens melanin-concentrating hormone receptor 1 protein. Length = 296 Score = 33.1 bits (72), Expect = 0.72 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +1 Query: 298 RNAMEATLAVCLVFFVLWMLFSWLLLVGLFKNKPCLVLSYL 420 + +A+CLVFFV W + L L L ++P L YL Sbjct: 195 KRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYL 235 >Z86090-3|CAI17933.1| 422|Homo sapiens melanin-concentrating hormone receptor 1 protein. Length = 422 Score = 33.1 bits (72), Expect = 0.72 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +1 Query: 298 RNAMEATLAVCLVFFVLWMLFSWLLLVGLFKNKPCLVLSYL 420 + +A+CLVFFV W + L L L ++P L YL Sbjct: 321 KRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYL 361 >U71092-1|AAC14587.1| 402|Homo sapiens somatostatin receptor-like protein protein. Length = 402 Score = 33.1 bits (72), Expect = 0.72 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +1 Query: 298 RNAMEATLAVCLVFFVLWMLFSWLLLVGLFKNKPCLVLSYL 420 + +A+CLVFFV W + L L L ++P L YL Sbjct: 301 KRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYL 341 >CR456497-1|CAG30383.1| 422|Homo sapiens GPR24 protein. Length = 422 Score = 33.1 bits (72), Expect = 0.72 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +1 Query: 298 RNAMEATLAVCLVFFVLWMLFSWLLLVGLFKNKPCLVLSYL 420 + +A+CLVFFV W + L L L ++P L YL Sbjct: 321 KRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYL 361 >BT006725-1|AAP35371.1| 422|Homo sapiens G protein-coupled receptor 24 protein. Length = 422 Score = 33.1 bits (72), Expect = 0.72 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +1 Query: 298 RNAMEATLAVCLVFFVLWMLFSWLLLVGLFKNKPCLVLSYL 420 + +A+CLVFFV W + L L L ++P L YL Sbjct: 321 KRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYL 361 >BC021146-1|AAH21146.1| 422|Homo sapiens melanin-concentrating hormone receptor 1 protein. Length = 422 Score = 33.1 bits (72), Expect = 0.72 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +1 Query: 298 RNAMEATLAVCLVFFVLWMLFSWLLLVGLFKNKPCLVLSYL 420 + +A+CLVFFV W + L L L ++P L YL Sbjct: 321 KRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYL 361 >BC001736-1|AAH01736.1| 422|Homo sapiens melanin-concentrating hormone receptor 1 protein. Length = 422 Score = 33.1 bits (72), Expect = 0.72 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +1 Query: 298 RNAMEATLAVCLVFFVLWMLFSWLLLVGLFKNKPCLVLSYL 420 + +A+CLVFFV W + L L L ++P L YL Sbjct: 321 KRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYL 361 >AY747629-1|AAV98053.1| 296|Homo sapiens G-protein coupled receptor 24 isoform 1 protein. Length = 296 Score = 33.1 bits (72), Expect = 0.72 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +1 Query: 298 RNAMEATLAVCLVFFVLWMLFSWLLLVGLFKNKPCLVLSYL 420 + +A+CLVFFV W + L L L ++P L YL Sbjct: 195 KRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYL 235 >AY745811-1|AAV98052.1| 311|Homo sapiens G-protein coupled receptor 24 isoform 2 protein. Length = 311 Score = 33.1 bits (72), Expect = 0.72 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +1 Query: 298 RNAMEATLAVCLVFFVLWMLFSWLLLVGLFKNKPCLVLSYL 420 + +A+CLVFFV W + L L L ++P L YL Sbjct: 210 KRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYL 250 >AY562945-1|AAS72373.1| 422|Homo sapiens melanin-concentrating hormone receptor 1 protein. Length = 422 Score = 33.1 bits (72), Expect = 0.72 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +1 Query: 298 RNAMEATLAVCLVFFVLWMLFSWLLLVGLFKNKPCLVLSYL 420 + +A+CLVFFV W + L L L ++P L YL Sbjct: 321 KRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYL 361 >AF490537-1|AAO14670.1| 422|Homo sapiens G protein-coupled receptor 24 protein. Length = 422 Score = 33.1 bits (72), Expect = 0.72 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +1 Query: 298 RNAMEATLAVCLVFFVLWMLFSWLLLVGLFKNKPCLVLSYL 420 + +A+CLVFFV W + L L L ++P L YL Sbjct: 321 KRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYL 361 >AB063174-1|BAB60890.1| 422|Homo sapiens somatostatin receptor-like protein protein. Length = 422 Score = 33.1 bits (72), Expect = 0.72 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +1 Query: 298 RNAMEATLAVCLVFFVLWMLFSWLLLVGLFKNKPCLVLSYL 420 + +A+CLVFFV W + L L L ++P L YL Sbjct: 321 KRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYL 361 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 70,571,503 Number of Sequences: 237096 Number of extensions: 1280404 Number of successful extensions: 2643 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2554 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2643 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5929224630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -