BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_M10 (595 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CY... 24 4.3 AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 23 9.8 >AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CYP12F2 protein. Length = 522 Score = 23.8 bits (49), Expect = 4.3 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +2 Query: 104 SILQCSLQYSRCSGNMVPRNCCRTKPEEVPLVSSKLP 214 ++LQ S +Y R + +P +P +VP V P Sbjct: 420 AVLQRSEKYFRRASEYLPERWLSERPADVPSVKDSNP 456 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 22.6 bits (46), Expect = 9.8 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -1 Query: 589 YCNNKFYLLFITDLNDHFV 533 + +FY LFI D HF+ Sbjct: 389 FVGQQFYKLFIVDFATHFL 407 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 561,548 Number of Sequences: 2352 Number of extensions: 10780 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57188952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -