BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_L24 (650 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 25 0.48 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 23 3.4 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 7.8 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 21 7.8 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 25.4 bits (53), Expect = 0.48 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 626 SSWLRLFPAVIPWCRWFIILLTSHVARPASVP 531 S+W R F A+I W +FI++ T + VP Sbjct: 399 SAW-RHFAAIIEWLSFFIVIFTYIIILITLVP 429 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 22.6 bits (46), Expect = 3.4 Identities = 17/74 (22%), Positives = 34/74 (45%) Frame = +2 Query: 92 EQSSQKNVPLGXNMSNVTNQNGTGLEQQLAGLDLQPQAPKSTGRYIPPHLRRQLQATSDQ 271 +Q+ Q+ + L + N+ +G + AGL K+TG + + TS Q Sbjct: 1234 QQTQQQPIILPSQLLNIKTLHGLKVIPTPAGL-------KTTGAAVYARVIAPTTITSSQ 1286 Query: 272 GEESKRSSLXTRPS 313 +++ ++ T+PS Sbjct: 1287 SPGNQQQTIQTQPS 1300 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.4 bits (43), Expect = 7.8 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +3 Query: 195 SPRLLRVLVATYPRICVGSCRQPLIKGK 278 SPR R+LVAT + C PL+ K Sbjct: 178 SPRRARLLVATVWILSFVICFPPLVGWK 205 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.4 bits (43), Expect = 7.8 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Frame = -3 Query: 345 PPNDERLSRDS---LGRVXKLERLDSSP*SE 262 PPNDE + DS G + + LDS+ S+ Sbjct: 195 PPNDEGIETDSDRRKGSIARCWSLDSTAASD 225 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,420 Number of Sequences: 438 Number of extensions: 3101 Number of successful extensions: 16 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -