BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_L13 (656 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0359 - 28269236-28269541,28270857-28270919,28271439-282714... 34 0.087 01_06_1488 + 37716986-37717076,37717424-37717558,37717755-377178... 32 0.46 01_06_1214 + 35470688-35471340,35471617-35471701,35471750-354719... 31 0.81 06_01_0090 - 724296-724532,724756-724938,725038-725088,725520-72... 28 7.5 >02_05_0359 - 28269236-28269541,28270857-28270919,28271439-28271459, 28271660-28271716,28271789-28271874,28271982-28272039, 28272176-28272311,28272799-28273073,28273564-28273602, 28274052-28274143,28274422-28274454,28275041-28275088, 28275191-28275323 Length = 448 Score = 34.3 bits (75), Expect = 0.087 Identities = 14/33 (42%), Positives = 23/33 (69%) Frame = +3 Query: 225 LSNRVXIATPLNSWKRLIEGVYLYDQNINPYEG 323 L++R ++TPL S +RL EG +L +++PY G Sbjct: 29 LASRPEVSTPLTSIRRLAEGYWLKQASMSPYSG 61 >01_06_1488 + 37716986-37717076,37717424-37717558,37717755-37717831, 37717934-37718181,37718503-37718559,37718665-37718800, 37718944-37719001,37719110-37719195,37719270-37719326, 37719537-37719557,37720553-37720954,37721500-37721647, 37721940-37722036,37724065-37724202,37724496-37724598, 37724792-37724828,37724905-37725014,37725141-37725164 Length = 674 Score = 31.9 bits (69), Expect = 0.46 Identities = 10/25 (40%), Positives = 20/25 (80%) Frame = +3 Query: 576 VYLFNPYSILNCVGMTTTVLXNMLL 650 +YL+NP++I+ CVG T+ + N+++ Sbjct: 42 IYLWNPWAIVTCVGSCTSPIENLMV 66 >01_06_1214 + 35470688-35471340,35471617-35471701,35471750-35471906, 35472086-35472189 Length = 332 Score = 31.1 bits (67), Expect = 0.81 Identities = 13/48 (27%), Positives = 28/48 (58%) Frame = +3 Query: 219 HTLSNRVXIATPLNSWKRLIEGVYLYDQNINPYEGDAFHESPIVLVIF 362 H++ N ++ W+R +E ++ + N +E AFH SP+++++F Sbjct: 167 HSIKNVTVDGVEID-WEREVEEGWVKEINCLEWESFAFHPSPLIVLVF 213 >06_01_0090 - 724296-724532,724756-724938,725038-725088,725520-725639, 725738-725840,726106-726264,726728-726846,726891-727004, 727119-727277,727404-727451,728464-728640,729064-729116, 729549-729661,729793-729873,729966-730081,730786-730905, 732321-732429,732593-732770,732852-732920,733102-733233, 733657-733766,733843-734003,734081-734171,734258-734355, 734499-734619,734732-734892,734985-735090,735142-735236, 735828-735852,736008-736084,736196-736282,736372-736421, 736558-736639,736735-736795,737064-737116,737206-737395, 737472-737595,737860-737962,738064-738156,740344-740422, 740508-740584,740915-741043,742614-742731,742816-742913, 743457-743546,744998-745123,745238-745351,745488-745611, 745865-746019,746104-746201,746357-746600 Length = 1926 Score = 27.9 bits (59), Expect = 7.5 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 2/63 (3%) Frame = +3 Query: 327 AFHESPIVLVIFHYLLKHVP--YSLPFIFSAMDLLTAYLLYKTSXGFVXIFLNCQXKYLS 500 AFH I + L+ P + L FI +D+L + YKT+ GF L + +L+ Sbjct: 521 AFHHGKIDIGTIKILVSAGPAFFILNFIECCLDVLLMFGAYKTARGFALSRLVIRFIWLT 580 Query: 501 HVS 509 VS Sbjct: 581 AVS 583 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,821,548 Number of Sequences: 37544 Number of extensions: 266886 Number of successful extensions: 396 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 388 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 396 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1644004708 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -