BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_L09 (647 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A6L009 Cluster: Putative TonB-dependent receptor; n=1; ... 33 6.0 UniRef50_Q5BXC7 Cluster: SJCHGC04725 protein; n=1; Schistosoma j... 33 7.9 >UniRef50_A6L009 Cluster: Putative TonB-dependent receptor; n=1; Bacteroides vulgatus ATCC 8482|Rep: Putative TonB-dependent receptor - Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) Length = 565 Score = 33.1 bits (72), Expect = 6.0 Identities = 18/48 (37%), Positives = 22/48 (45%) Frame = -1 Query: 284 YRTVKDVCPFWLLPPHARSSYSP*IIHLIFDHSPVAGSHFNSVGRYSV 141 YR + P+W L S+Y P L F SPV G FN G Y + Sbjct: 354 YRRLNAFSPYWSLNARMPSTYVPLNATLGFKASPVNGLWFNVFGGYRI 401 >UniRef50_Q5BXC7 Cluster: SJCHGC04725 protein; n=1; Schistosoma japonicum|Rep: SJCHGC04725 protein - Schistosoma japonicum (Blood fluke) Length = 218 Score = 32.7 bits (71), Expect = 7.9 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 92 NGHSIPSASVGKKNYKQPSTYLHY*SAIRRRV 187 NGH K+NY++P T+ H S++ RRV Sbjct: 38 NGHEFSPGGFKKRNYQKPRTFKHIVSSVCRRV 69 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 526,376,566 Number of Sequences: 1657284 Number of extensions: 8772655 Number of successful extensions: 13063 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12817 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13063 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 48955894634 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -