BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_L09 (647 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC23E6.09 |ssn6||transcriptional corepressor Ssn6|Schizosaccha... 27 3.1 SPBC649.03 |rhp14||XP-A family homolog Rhp14|Schizosaccharomyces... 25 7.1 >SPBC23E6.09 |ssn6||transcriptional corepressor Ssn6|Schizosaccharomyces pombe|chr 2|||Manual Length = 1102 Score = 26.6 bits (56), Expect = 3.1 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +1 Query: 106 SISLGREKKL*TTEYLPTLLKCDPATGE-WS 195 +I RE+ EY T+L CDP GE WS Sbjct: 376 TILRNREQFPLAIEYYQTILDCDPKQGEIWS 406 >SPBC649.03 |rhp14||XP-A family homolog Rhp14|Schizosaccharomyces pombe|chr 2|||Manual Length = 289 Score = 25.4 bits (53), Expect = 7.1 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 124 EKKL*TTEYLPTLLKCDPATGEWSNI 201 E +L E LP LLK +P WSN+ Sbjct: 164 EPELQDQELLPRLLKANPHQQGWSNM 189 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,208,138 Number of Sequences: 5004 Number of extensions: 38141 Number of successful extensions: 60 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 291768710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -