BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_L06 (554 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g57860.1 68414.m06565 60S ribosomal protein L21 similar to 60... 142 1e-34 At1g57660.1 68414.m06543 60S ribosomal protein L21 (RPL21E) simi... 142 1e-34 At1g09690.1 68414.m01088 60S ribosomal protein L21 (RPL21C) Simi... 142 1e-34 At1g09590.1 68414.m01076 60S ribosomal protein L21 (RPL21A) Simi... 142 1e-34 At5g25320.1 68418.m03004 ACT domain-containing protein contains ... 29 1.6 At4g02670.1 68417.m00362 zinc finger (C2H2 type) family protein ... 29 1.6 At3g45260.1 68416.m04887 zinc finger (C2H2 type) family protein ... 29 2.1 At5g66730.1 68418.m08412 zinc finger (C2H2 type) family protein ... 29 2.8 At3g50700.1 68416.m05547 zinc finger (C2H2 type) family protein ... 29 2.8 At2g02080.1 68415.m00144 zinc finger (C2H2 type) family protein ... 29 2.8 At2g02070.1 68415.m00143 zinc finger (C2H2 type) family protein ... 29 2.8 At1g14580.1 68414.m01734 zinc finger (C2H2 type) family protein ... 29 2.8 At2g13150.1 68415.m01450 expressed protein contains a bZIP trans... 28 4.8 At1g20020.1 68414.m02507 ferredoxin--NADP(+) reductase, putative... 28 4.8 At1g62330.1 68414.m07033 expressed protein contains Pfam PF03138... 27 6.4 At5g44160.1 68418.m05404 zinc finger (C2H2 type) family protein ... 27 8.4 At5g05900.1 68418.m00651 UDP-glucoronosyl/UDP-glucosyl transfera... 27 8.4 At5g03150.1 68418.m00263 zinc finger (C2H2 type) family protein ... 27 8.4 At4g31670.1 68417.m04497 ubiquitin carboxyl-terminal hydrolase f... 27 8.4 At1g76990.3 68414.m08966 ACT domain containing protein low simil... 27 8.4 At1g76990.2 68414.m08965 ACT domain containing protein low simil... 27 8.4 At1g76990.1 68414.m08964 ACT domain containing protein low simil... 27 8.4 At1g03840.1 68414.m00365 zinc finger (C2H2 type) family protein ... 27 8.4 >At1g57860.1 68414.m06565 60S ribosomal protein L21 similar to 60S ribosomal protein L21 GI:3885884 from [Oryza sativa] Length = 164 Score = 142 bits (345), Expect = 1e-34 Identities = 65/129 (50%), Positives = 90/129 (69%) Frame = +1 Query: 133 YMKVYKVGDIVXIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 312 Y++ +KVGD V ++ NGA+ KGMPHK YHG+TGR++NVT A+GV VNK++ RII KRI Sbjct: 30 YLRTFKVGDYVDVKVNGAIHKGMPHKFYHGRTGRIWNVTKRAVGVEVNKQIGNRIIRKRI 89 Query: 313 NIRVEHVKHSKCXQDFLXXVKXNXRLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEKPVL 492 ++RVEHV+ S+C ++F K N L +AKA G+T++ KRQP PK +V G Sbjct: 90 HVRVEHVQQSRCAEEFKLRKKQNDVLKADAKARGETISTKRQPKGPKPGFMVEGMTLET- 148 Query: 493 LAPIPYEFV 519 + PIPY+ V Sbjct: 149 VTPIPYDVV 157 >At1g57660.1 68414.m06543 60S ribosomal protein L21 (RPL21E) similar to 60S ribosomal protein L21 GB:Q43291 GI:2851508 from [Arabidopsis thaliana] Length = 164 Score = 142 bits (345), Expect = 1e-34 Identities = 65/129 (50%), Positives = 90/129 (69%) Frame = +1 Query: 133 YMKVYKVGDIVXIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 312 Y++ +KVGD V ++ NGA+ KGMPHK YHG+TGR++NVT A+GV VNK++ RII KRI Sbjct: 30 YLRTFKVGDYVDVKVNGAIHKGMPHKFYHGRTGRIWNVTKRAVGVEVNKQIGNRIIRKRI 89 Query: 313 NIRVEHVKHSKCXQDFLXXVKXNXRLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEKPVL 492 ++RVEHV+ S+C ++F K N L +AKA G+T++ KRQP PK +V G Sbjct: 90 HVRVEHVQQSRCAEEFKLRKKQNDVLKADAKARGETISTKRQPKGPKPGFMVEGMTLET- 148 Query: 493 LAPIPYEFV 519 + PIPY+ V Sbjct: 149 VTPIPYDVV 157 >At1g09690.1 68414.m01088 60S ribosomal protein L21 (RPL21C) Similar to ribosomal protein L21 (gb|L38826). ESTs gb|AA395597,gb|ATTS5197 come from this gene Length = 164 Score = 142 bits (344), Expect = 1e-34 Identities = 65/129 (50%), Positives = 89/129 (68%) Frame = +1 Query: 133 YMKVYKVGDIVXIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 312 Y++ +KVGD V ++ NGA+ KGMPHK YHG+TGR++NVT A+GV VNK++ RII KRI Sbjct: 30 YLRTFKVGDYVDVKVNGAIHKGMPHKFYHGRTGRIWNVTKRAVGVEVNKQIGNRIIRKRI 89 Query: 313 NIRVEHVKHSKCXQDFLXXVKXNXRLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEKPVL 492 ++RVEHV+ S+C ++F K N L AKA G+T++ KRQP PK +V G Sbjct: 90 HVRVEHVQQSRCAEEFKLRKKKNDELKAAAKANGETISTKRQPKGPKPGFMVEGMTLET- 148 Query: 493 LAPIPYEFV 519 + PIPY+ V Sbjct: 149 VTPIPYDVV 157 >At1g09590.1 68414.m01076 60S ribosomal protein L21 (RPL21A) Similar to L21 family of ribosomal protein; amino acid sequence is identical to F21M12.8 Length = 164 Score = 142 bits (344), Expect = 1e-34 Identities = 65/129 (50%), Positives = 89/129 (68%) Frame = +1 Query: 133 YMKVYKVGDIVXIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 312 Y++ +KVGD V ++ NGA+ KGMPHK YHG+TGR++NVT A+GV VNK++ RII KRI Sbjct: 30 YLRTFKVGDYVDVKVNGAIHKGMPHKFYHGRTGRIWNVTKRAVGVEVNKQIGNRIIRKRI 89 Query: 313 NIRVEHVKHSKCXQDFLXXVKXNXRLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEKPVL 492 ++RVEHV+ S+C ++F K N L AKA G+T++ KRQP PK +V G Sbjct: 90 HVRVEHVQQSRCAEEFKLRKKKNDELKAAAKANGETISTKRQPKGPKPGFMVEGMTLET- 148 Query: 493 LAPIPYEFV 519 + PIPY+ V Sbjct: 149 VTPIPYDVV 157 >At5g25320.1 68418.m03004 ACT domain-containing protein contains Pfam ACT domain PF01842 Length = 500 Score = 29.5 bits (63), Expect = 1.6 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 4/48 (8%) Frame = +3 Query: 183 CSSKGYATQSIPWKDRSRVQRDCSCSRCDCQ----QACSRKDYTEAHQ 314 C +GY+ ++ KDR R+ D C+ D Q A R D +A Q Sbjct: 291 CEERGYSIVTVKSKDRRRLMFDTICTLVDMQYVIFHAALRSDGADAFQ 338 >At4g02670.1 68417.m00362 zinc finger (C2H2 type) family protein similar to potato PCP1 zinc finger protein, GenBank accession number X82328 contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 402 Score = 29.5 bits (63), Expect = 1.6 Identities = 22/56 (39%), Positives = 29/56 (51%), Gaps = 5/56 (8%) Frame = +3 Query: 171 QRQW-CS--SKGYATQSIPWKDRSRV--QRDCSCSRCDCQQACSRKDYTEAHQYPC 323 +++W C SK YA QS WK +++ RD RCDC SRKD H+ C Sbjct: 156 EKKWKCEKCSKFYAVQS-DWKAHTKICGTRDY---RCDCGTLFSRKDTFITHRAFC 207 >At3g45260.1 68416.m04887 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 446 Score = 29.1 bits (62), Expect = 2.1 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 5/56 (8%) Frame = +3 Query: 171 QRQW-CS--SKGYATQSIPWKDRSRVQRDCSCS--RCDCQQACSRKDYTEAHQYPC 323 +++W C SK YA S WK S++ C RCDC SRKD H+ C Sbjct: 142 EKKWKCDKCSKKYAVMS-DWKAHSKI---CGTKEYRCDCGTLFSRKDSFITHRAFC 193 >At5g66730.1 68418.m08412 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 500 Score = 28.7 bits (61), Expect = 2.8 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 5/56 (8%) Frame = +3 Query: 171 QRQW-CS--SKGYATQSIPWKDRSRVQRDCSCS--RCDCQQACSRKDYTEAHQYPC 323 +++W C SK YA QS WK S++ C +CDC SR+D H+ C Sbjct: 134 EKKWKCEKCSKKYAVQS-DWKAHSKI---CGTKEYKCDCGTLFSRRDSFITHRAFC 185 >At3g50700.1 68416.m05547 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 452 Score = 28.7 bits (61), Expect = 2.8 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 5/56 (8%) Frame = +3 Query: 171 QRQW-CS--SKGYATQSIPWKDRSRVQRDCSCS--RCDCQQACSRKDYTEAHQYPC 323 +++W C SK YA QS WK S++ C +CDC SR+D H+ C Sbjct: 136 EKKWKCDKCSKKYAVQS-DWKAHSKI---CGTKEYKCDCGTLFSRRDSFITHRAFC 187 >At2g02080.1 68415.m00144 zinc finger (C2H2 type) family protein contains Pfam domain PF00096: Zinc finger, C2H2 type Length = 516 Score = 28.7 bits (61), Expect = 2.8 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 5/56 (8%) Frame = +3 Query: 171 QRQW-CS--SKGYATQSIPWKDRSRVQRDCSCS--RCDCQQACSRKDYTEAHQYPC 323 +++W C SK YA QS WK S+ C RCDC SR+D H+ C Sbjct: 156 EKKWKCEKCSKRYAVQS-DWKAHSKT---CGTKEYRCDCGTIFSRRDSYITHRAFC 207 >At2g02070.1 68415.m00143 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 602 Score = 28.7 bits (61), Expect = 2.8 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 5/56 (8%) Frame = +3 Query: 171 QRQW-CS--SKGYATQSIPWKDRSRVQRDCSCS--RCDCQQACSRKDYTEAHQYPC 323 +++W C SK YA QS WK S+ C RCDC SR+D H+ C Sbjct: 154 EKKWKCDKCSKRYAVQS-DWKAHSKT---CGTKEYRCDCGTLFSRRDSFITHRAFC 205 >At1g14580.1 68414.m01734 zinc finger (C2H2 type) family protein similar to zinc finger protein ID1 GB:AAC18941 GI:3170601 from [Zea mays] contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 467 Score = 28.7 bits (61), Expect = 2.8 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 5/56 (8%) Frame = +3 Query: 171 QRQW-CS--SKGYATQSIPWKDRSRVQRDCSCS--RCDCQQACSRKDYTEAHQYPC 323 +++W C SK YA QS WK S+ C RCDC SR+D H+ C Sbjct: 155 EKKWKCDKCSKRYAVQS-DWKAHSKT---CGTKEYRCDCGTIFSRRDSYITHRAFC 206 >At2g13150.1 68415.m01450 expressed protein contains a bZIP transcription factor basic domain signature (PDOC00036) Length = 262 Score = 27.9 bits (59), Expect = 4.8 Identities = 19/55 (34%), Positives = 28/55 (50%) Frame = +2 Query: 326 SMSSTPSAXKTSLXXSXXMXGY*RKPRLPARPST*RDSQLPLKLPTSSVELRNPS 490 S +STPS ++ S P L PS+ R + +PL P++SVE R+ S Sbjct: 4 SDNSTPSRPRSITQPSLAFSSL---PPLSPSPSSSRRNSIPLMNPSASVESRDSS 55 >At1g20020.1 68414.m02507 ferredoxin--NADP(+) reductase, putative / adrenodoxin reductase, putative strong similarity to Ferredoxin--NADP reductase, chloroplast precursor (EC 1.18.1.2) (FNR) from {Pisum sativum} SP|P10933, {Mesembryanthemum crystallinum} SP|P41343, {Spinacia oleracea} SP|P00455, [Capsicum annuum] GI:6899972 Length = 369 Score = 27.9 bits (59), Expect = 4.8 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +1 Query: 145 YKVGDIVXIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVN 276 Y+ G V + +G + G PHKV R+Y++ + ALG + N Sbjct: 125 YREGQSVGVIADGIDKNGKPHKV------RLYSIASSALGDLGN 162 >At1g62330.1 68414.m07033 expressed protein contains Pfam PF03138: Plant protein family. The function of this family of plant proteins is unknown; Length = 672 Score = 27.5 bits (58), Expect = 6.4 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +1 Query: 196 GMPHKVYHGKTGRVYNVTAHALGVIVNK 279 G P K Y+G GR+ AHAL NK Sbjct: 182 GKPKKTYNGTYGRLLAYAAHALAEGQNK 209 >At5g44160.1 68418.m05404 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 466 Score = 27.1 bits (57), Expect = 8.4 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 5/56 (8%) Frame = +3 Query: 171 QRQW-CS--SKGYATQSIPWKDRSRVQRDCSCS--RCDCQQACSRKDYTEAHQYPC 323 +++W C +K YA QS WK S+ C RCDC SR+D H+ C Sbjct: 139 EKKWTCEKCAKRYAVQS-DWKAHSKT---CGTREYRCDCGTIFSRRDSFITHRAFC 190 >At5g05900.1 68418.m00651 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 450 Score = 27.1 bits (57), Expect = 8.4 Identities = 15/52 (28%), Positives = 21/52 (40%) Frame = -3 Query: 312 DALRYNPSANTLVDNHTESMSSHVVHATCLSMVYFVWHTLLNCTIASDVYNV 157 + L++ L N S V + + FVW LLN SDV+ V Sbjct: 335 EVLKHQAIGGFLTHNGWNSTVESVFEGVPMICMPFVWDQLLNARFVSDVWMV 386 >At5g03150.1 68418.m00263 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 503 Score = 27.1 bits (57), Expect = 8.4 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 5/56 (8%) Frame = +3 Query: 171 QRQW-CS--SKGYATQSIPWKDRSRVQRDCSCS--RCDCQQACSRKDYTEAHQYPC 323 +++W C SK YA QS WK ++ C +CDC SRKD H+ C Sbjct: 156 EKKWKCEKCSKKYAVQS-DWKAHAKT---CGTREYKCDCGTLFSRKDSFITHRAFC 207 >At4g31670.1 68417.m04497 ubiquitin carboxyl-terminal hydrolase family protein / zinc finger (MYND type) family protein similar to ubiquitin-specific protease 15 (UBP15) [Arabidopsis thaliana] GI:11993475; contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF01753: MYND finger Length = 631 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/27 (40%), Positives = 13/27 (48%), Gaps = 4/27 (14%) Frame = +3 Query: 255 CSRCD----CQQACSRKDYTEAHQYPC 323 CSRC C C R D++ HQ C Sbjct: 72 CSRCKSVRYCSAECQRSDWSSGHQRNC 98 >At1g76990.3 68414.m08966 ACT domain containing protein low similarity to uridylyltransferase SP|P56884 from Rhizobium meliloti; contains Pfam ACT domain PF01842 Length = 453 Score = 27.1 bits (57), Expect = 8.4 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 183 CSSKGYATQSIPWKDRSRVQRDCSCSRCDCQ 275 C KGY+ ++ +DR ++ D C+ D Q Sbjct: 259 CEEKGYSVINVSCEDRPKLMFDIVCTLTDMQ 289 >At1g76990.2 68414.m08965 ACT domain containing protein low similarity to uridylyltransferase SP|P56884 from Rhizobium meliloti; contains Pfam ACT domain PF01842 Length = 453 Score = 27.1 bits (57), Expect = 8.4 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 183 CSSKGYATQSIPWKDRSRVQRDCSCSRCDCQ 275 C KGY+ ++ +DR ++ D C+ D Q Sbjct: 259 CEEKGYSVINVSCEDRPKLMFDIVCTLTDMQ 289 >At1g76990.1 68414.m08964 ACT domain containing protein low similarity to uridylyltransferase SP|P56884 from Rhizobium meliloti; contains Pfam ACT domain PF01842 Length = 453 Score = 27.1 bits (57), Expect = 8.4 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 183 CSSKGYATQSIPWKDRSRVQRDCSCSRCDCQ 275 C KGY+ ++ +DR ++ D C+ D Q Sbjct: 259 CEEKGYSVINVSCEDRPKLMFDIVCTLTDMQ 289 >At1g03840.1 68414.m00365 zinc finger (C2H2 type) family protein contains Zinc finger,C2H2 type,domain contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 506 Score = 27.1 bits (57), Expect = 8.4 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 5/56 (8%) Frame = +3 Query: 171 QRQW-CS--SKGYATQSIPWKDRSRVQRDCSCS--RCDCQQACSRKDYTEAHQYPC 323 +++W C +K YA QS WK S+ C RCDC SR+D H+ C Sbjct: 143 EKKWKCEKCAKRYAVQS-DWKAHSKT---CGTREYRCDCGTIFSRRDSFITHRAFC 194 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,133,810 Number of Sequences: 28952 Number of extensions: 218343 Number of successful extensions: 602 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 588 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 602 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1053014392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -