BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_L05 (409 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL110490-2|CAB54440.1| 91|Caenorhabditis elegans Hypothetical ... 127 3e-30 Z66524-1|CAA91420.2| 500|Caenorhabditis elegans Hypothetical pr... 33 0.10 U41534-3|AAB47595.1| 1119|Caenorhabditis elegans Hypothetical pr... 28 2.3 >AL110490-2|CAB54440.1| 91|Caenorhabditis elegans Hypothetical protein Y48B6A.2 protein. Length = 91 Score = 127 bits (307), Expect = 3e-30 Identities = 55/88 (62%), Positives = 66/88 (75%) Frame = +1 Query: 55 MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 234 MAKRTKKVGI GKYGTRYGASLRKM KK+EV QH++YTCSFCGK+AMKR GIW+C +C Sbjct: 1 MAKRTKKVGIVGKYGTRYGASLRKMAKKLEVAQHSRYTCSFCGKEAMKRKATGIWNCAKC 60 Query: 235 KRTVXXGAWVFXXXXXXXXXXXVRRLRE 318 + V GA+V+ +RRLR+ Sbjct: 61 HKVVAGGAYVYGTVTAATVRSTIRRLRD 88 >Z66524-1|CAA91420.2| 500|Caenorhabditis elegans Hypothetical protein T13H5.4 protein. Length = 500 Score = 32.7 bits (71), Expect = 0.10 Identities = 17/55 (30%), Positives = 27/55 (49%) Frame = +3 Query: 18 FSVNFCIGEVYQNGQTYQKGWNYWQIWHTLRCLST*NGQKDGSNPTRKVYLLILW 182 +S C + Y+ + +QK +N W+ H +RCL N +N T+ L LW Sbjct: 405 YSCEICGNQTYKGPKAFQKHFNEWRHSHGMRCLGIPN-TSHFANITKIKDALDLW 458 >U41534-3|AAB47595.1| 1119|Caenorhabditis elegans Hypothetical protein C16A3.7 protein. Length = 1119 Score = 28.3 bits (60), Expect = 2.3 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +1 Query: 151 QHAKYTCSFCGKDAMKRSCVGIWSCKRC 234 ++ KY C+ C R G+WSCK C Sbjct: 229 ENNKYECAICYTRITTRQ--GVWSCKTC 254 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,664,452 Number of Sequences: 27780 Number of extensions: 153062 Number of successful extensions: 462 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 451 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 462 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 651753158 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -