BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_K17 (652 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory pro... 24 1.2 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 23 1.6 DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 23 2.2 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 5.0 AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 prot... 22 5.0 >DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory protein 7 protein. Length = 127 Score = 23.8 bits (49), Expect = 1.2 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 56 ALVLCGLLAAVSAAPQYY 109 A++LC L AVSAA Y Sbjct: 6 AVILCAFLVAVSAAENKY 23 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 23.4 bits (48), Expect = 1.6 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +3 Query: 417 NLPWDVNSEGSWV 455 N WDV+S GSW+ Sbjct: 187 NAWWDVHSTGSWL 199 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 23.0 bits (47), Expect = 2.2 Identities = 15/48 (31%), Positives = 27/48 (56%) Frame = +2 Query: 50 MIALVLCGLLAAVSAAPQYYHGSSHWPYHHYDPLQSLRSGKHVGHTFA 193 MI L+ + AVSAAP ++ S Y H D ++S+ + + + + +A Sbjct: 1 MIPLIAIAGILAVSAAPAEFYESR---YDHLD-VESILNNRRMVNYYA 44 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 5.0 Identities = 6/10 (60%), Positives = 10/10 (100%) Frame = +1 Query: 610 TSAWRQPTRP 639 TS+W++PT+P Sbjct: 1163 TSSWQKPTKP 1172 >AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 protein. Length = 377 Score = 21.8 bits (44), Expect = 5.0 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +2 Query: 119 SHWPYHHYDPLQSLRSG-KHVGHTFALVQPCQRNATLGQHDEG 244 +HW DP Q L G GH F LV Q + LG G Sbjct: 238 THWILSGADP-QKLAIGIAFYGHAFTLVDASQHD--LGSPSSG 277 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,249 Number of Sequences: 336 Number of extensions: 2900 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -