BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_K17 (652 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ518576-1|ABF66618.1| 276|Anopheles gambiae putative cytoplasm... 25 2.7 AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CY... 24 3.6 AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CY... 24 3.6 AY825734-1|AAV70297.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825733-1|AAV70296.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825732-1|AAV70295.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825731-1|AAV70294.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825728-1|AAV70291.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825727-1|AAV70290.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825724-1|AAV70287.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825723-1|AAV70286.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825722-1|AAV70285.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825721-1|AAV70284.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825720-1|AAV70283.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825719-1|AAV70282.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825718-1|AAV70281.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825717-1|AAV70280.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825716-1|AAV70279.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825715-1|AAV70278.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825714-1|AAV70277.1| 156|Anopheles gambiae subtilase serine p... 23 6.3 AY825713-1|AAV70276.1| 156|Anopheles gambiae subtilase serine p... 23 6.3 AY825710-1|AAV70273.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825709-1|AAV70272.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825708-1|AAV70271.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825707-1|AAV70270.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825706-1|AAV70269.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825705-1|AAV70268.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825704-1|AAV70267.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825703-1|AAV70266.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825702-1|AAV70265.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825701-1|AAV70264.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825698-1|AAV70261.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825697-1|AAV70260.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825694-1|AAV70257.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825693-1|AAV70256.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825692-1|AAV70255.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825691-1|AAV70254.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825688-1|AAV70251.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825687-1|AAV70250.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825686-1|AAV70249.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY825685-1|AAV70248.1| 159|Anopheles gambiae subtilase serine p... 23 6.3 AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CY... 23 6.3 AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease pr... 23 6.3 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 8.4 AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. 23 8.4 AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. 23 8.4 AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. 23 8.4 AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 23 8.4 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 23 8.4 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 8.4 AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 23 8.4 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 23 8.4 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 23 8.4 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 23 8.4 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 23 8.4 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 23 8.4 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 23 8.4 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 23 8.4 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 23 8.4 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 23 8.4 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 23 8.4 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 23 8.4 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 23 8.4 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 23 8.4 >DQ518576-1|ABF66618.1| 276|Anopheles gambiae putative cytoplasmic carbonic anhydrase protein. Length = 276 Score = 24.6 bits (51), Expect = 2.7 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +1 Query: 136 PLRPPSVLTFGKACWTHIRFGPTLP-TKCNTW 228 PL P +L GKA WT++ T P ++ TW Sbjct: 180 PLDPARLLPEGKAYWTYLGSLTTPPCSESVTW 211 >AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CYPm3r9 protein. Length = 499 Score = 24.2 bits (50), Expect = 3.6 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +3 Query: 213 EMQHLDNMMKELSLKFPXIINEGRVEGDKYXISIHLPG 326 EM++LD ++ E K+P + RV Y H+PG Sbjct: 352 EMKYLDQILNESLRKYPPVPVHLRVASKDY----HVPG 385 >AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CYP6M1 protein. Length = 503 Score = 24.2 bits (50), Expect = 3.6 Identities = 9/33 (27%), Positives = 19/33 (57%) Frame = +3 Query: 210 NEMQHLDNMMKELSLKFPXIINEGRVEGDKYXI 308 ++M++LD ++KE K+P + R+ Y + Sbjct: 350 HDMKYLDQILKESLRKYPPVPMHFRMTAQDYRV 382 >AY825734-1|AAV70297.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825733-1|AAV70296.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825732-1|AAV70295.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825731-1|AAV70294.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825728-1|AAV70291.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825727-1|AAV70290.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825724-1|AAV70287.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825723-1|AAV70286.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825722-1|AAV70285.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825721-1|AAV70284.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825720-1|AAV70283.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825719-1|AAV70282.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825718-1|AAV70281.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825717-1|AAV70280.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825716-1|AAV70279.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825715-1|AAV70278.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825714-1|AAV70277.1| 156|Anopheles gambiae subtilase serine protease protein. Length = 156 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825713-1|AAV70276.1| 156|Anopheles gambiae subtilase serine protease protein. Length = 156 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825710-1|AAV70273.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825709-1|AAV70272.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825708-1|AAV70271.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825707-1|AAV70270.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825706-1|AAV70269.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825705-1|AAV70268.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825704-1|AAV70267.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825703-1|AAV70266.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825702-1|AAV70265.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825701-1|AAV70264.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825698-1|AAV70261.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825697-1|AAV70260.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825694-1|AAV70257.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825693-1|AAV70256.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825692-1|AAV70255.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825691-1|AAV70254.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825688-1|AAV70251.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825687-1|AAV70250.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825686-1|AAV70249.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY825685-1|AAV70248.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 191 RMCVQHAFPNVRTEG---GRNGDTANVTS 114 + CV H F + TEG + TAN T+ Sbjct: 8 KKCVSHCFQYILTEGPPAKKTSSTANATT 36 >AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CYPm3r10 protein. Length = 441 Score = 23.4 bits (48), Expect = 6.3 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +3 Query: 213 EMQHLDNMMKELSLKFPXIINEGRVEGDKYXI 308 EM +LD ++KE K+P + R +Y + Sbjct: 292 EMNYLDQILKESLRKYPPVPVHFRETSKEYQV 323 >AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease protein. Length = 364 Score = 23.4 bits (48), Expect = 6.3 Identities = 15/74 (20%), Positives = 38/74 (51%), Gaps = 2/74 (2%) Frame = +3 Query: 321 PGYEQKDINVKAKNGVLMVQANSAFNHYLKIQNLPWDVNSEGSWVYEKDVLKIT--FPLK 494 P Y+ +I+ +L + ++ FN Y++ LP+D + + + + ++ +T + Sbjct: 200 PEYDMHNISRPNDICILRLASDVTFNDYVRPICLPFDPDVQQLPIVD-EIFTVTGWGETE 258 Query: 495 QKQPEDSKRPVAXP 536 ++P D+++ V P Sbjct: 259 DRRPSDTQKHVELP 272 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 8.4 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 4/37 (10%) Frame = +2 Query: 377 AG*QCF*SLLENTEPSL----GCEFRRQLGLRERRVE 475 AG F +++ ++ PS+ G E +Q+GL ERRV+ Sbjct: 540 AGKTTFSNIIGSSGPSVTSCTGSEIDKQVGLWERRVK 576 >AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/20 (40%), Positives = 9/20 (45%) Frame = +1 Query: 574 WSSPPXATCGTLTSAWRQPT 633 WS P T T+ W PT Sbjct: 174 WSDQPPPPTTTTTTVWTDPT 193 >AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/20 (40%), Positives = 9/20 (45%) Frame = +1 Query: 574 WSSPPXATCGTLTSAWRQPT 633 WS P T T+ W PT Sbjct: 174 WSDQPPPPTTTTTTVWTDPT 193 >AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/20 (40%), Positives = 9/20 (45%) Frame = +1 Query: 574 WSSPPXATCGTLTSAWRQPT 633 WS P T T+ W PT Sbjct: 173 WSDQPPPPTTTTTTVWTDPT 192 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/20 (40%), Positives = 9/20 (45%) Frame = +1 Query: 574 WSSPPXATCGTLTSAWRQPT 633 WS P T T+ W PT Sbjct: 173 WSDQPPPPTTTTTTVWTDPT 192 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/20 (40%), Positives = 9/20 (45%) Frame = +1 Query: 574 WSSPPXATCGTLTSAWRQPT 633 WS P T T+ W PT Sbjct: 174 WSDQPRPPTTTTTTVWTDPT 193 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -1 Query: 301 YLSPSTRPSFIMXG 260 YL P TRPS ++ G Sbjct: 1157 YLQPKTRPSIMLPG 1170 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/20 (40%), Positives = 9/20 (45%) Frame = +1 Query: 574 WSSPPXATCGTLTSAWRQPT 633 WS P T T+ W PT Sbjct: 174 WSDQPPPPTTTTTTVWTDPT 193 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.0 bits (47), Expect = 8.4 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 110 HGSSHWPYHHY 142 HG SH +HHY Sbjct: 222 HGPSHLSHHHY 232 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 23.0 bits (47), Expect = 8.4 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 110 HGSSHWPYHHY 142 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.0 bits (47), Expect = 8.4 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 110 HGSSHWPYHHY 142 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 23.0 bits (47), Expect = 8.4 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 110 HGSSHWPYHHY 142 HG SH +HHY Sbjct: 224 HGPSHLSHHHY 234 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.0 bits (47), Expect = 8.4 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 110 HGSSHWPYHHY 142 HG SH +HHY Sbjct: 229 HGPSHLSHHHY 239 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.0 bits (47), Expect = 8.4 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 110 HGSSHWPYHHY 142 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.0 bits (47), Expect = 8.4 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 110 HGSSHWPYHHY 142 HG SH +HHY Sbjct: 229 HGPSHLSHHHY 239 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 23.0 bits (47), Expect = 8.4 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 110 HGSSHWPYHHY 142 HG SH +HHY Sbjct: 253 HGPSHLSHHHY 263 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 23.0 bits (47), Expect = 8.4 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 110 HGSSHWPYHHY 142 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.0 bits (47), Expect = 8.4 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 110 HGSSHWPYHHY 142 HG SH +HHY Sbjct: 222 HGPSHLSHHHY 232 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.0 bits (47), Expect = 8.4 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 110 HGSSHWPYHHY 142 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 23.0 bits (47), Expect = 8.4 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 110 HGSSHWPYHHY 142 HG SH +HHY Sbjct: 229 HGPSHLSHHHY 239 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.0 bits (47), Expect = 8.4 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 110 HGSSHWPYHHY 142 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 648,750 Number of Sequences: 2352 Number of extensions: 12425 Number of successful extensions: 105 Number of sequences better than 10.0: 64 Number of HSP's better than 10.0 without gapping: 96 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 105 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -