BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_K15 (654 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 24 1.5 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 23 2.6 DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein ... 22 6.0 AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein ... 22 6.0 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 7.9 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -3 Query: 415 GRDPTGNGSRLAAPSSPNCNTR 350 GR NGS +P SP N+R Sbjct: 310 GRGSVHNGSNNGSPRSPESNSR 331 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 23.0 bits (47), Expect = 2.6 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +3 Query: 297 HPTLFDVDLFLPEVTKKSLVLQFGELGAARR 389 +P +FD D FLPE T F A R Sbjct: 456 NPDVFDPDNFLPEKTANRHYYAFVPFSAGPR 486 >DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein 1 protein. Length = 116 Score = 21.8 bits (44), Expect = 6.0 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +1 Query: 298 ILHYLTWTYFFRRLLKNPSYYNLESLEPQD 387 IL LTWTY Y N++ + D Sbjct: 10 ILSLLTWTYAEELYSDKYDYVNIDEILAND 39 >AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein protein. Length = 116 Score = 21.8 bits (44), Expect = 6.0 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +1 Query: 298 ILHYLTWTYFFRRLLKNPSYYNLESLEPQD 387 IL LTWTY Y N++ + D Sbjct: 10 ILSLLTWTYAEELYSDKYDYVNIDEILAND 39 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +1 Query: 517 YLSHRTMAHFSXNLNGNMNVDDL 585 YL +H+ N NGN+ ++L Sbjct: 236 YLVSIMFSHYDRNNNGNLEREEL 258 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,731 Number of Sequences: 438 Number of extensions: 3636 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -