BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_J24 (649 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF100669-1|AAK39265.1| 931|Caenorhabditis elegans Hypothetical ... 42 5e-04 >AF100669-1|AAK39265.1| 931|Caenorhabditis elegans Hypothetical protein R11E3.3 protein. Length = 931 Score = 41.5 bits (93), Expect = 5e-04 Identities = 29/77 (37%), Positives = 38/77 (49%), Gaps = 2/77 (2%) Frame = -3 Query: 497 NCHHQMFGC-GTTDTNGVHLVEILDLQ-NLCLLNTGSPTRRTKPNEKPSAVDLSICTPDL 324 N HH + G+ DT G L E++DL +L + N TR S+ D++ICT DL Sbjct: 41 NAHHSAWHSEGSEDTRGRELAELIDLHPDLIIQNEQVHTRAD--TYSISSPDITICTADL 98 Query: 323 AXXHXWYTSSXTFGSDH 273 A W T GSDH Sbjct: 99 ATKCHWST-LYKLGSDH 114 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,233,880 Number of Sequences: 27780 Number of extensions: 207161 Number of successful extensions: 383 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 378 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 383 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1434198608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -