BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_J18 (653 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist mic... 25 2.8 AY146746-1|AAO12061.1| 333|Anopheles gambiae odorant-binding pr... 23 8.4 >DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist michelob_x protein. Length = 201 Score = 24.6 bits (51), Expect = 2.8 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = +1 Query: 190 QREGSRPKSPGIHSRVYLFVFKIRFVRHHCL 282 +++ +PK P I++ Y + + R + HH L Sbjct: 147 KKKKRKPKPPRIYNNNYYYNYYCRNISHHFL 177 >AY146746-1|AAO12061.1| 333|Anopheles gambiae odorant-binding protein AgamOBP43 protein. Length = 333 Score = 23.0 bits (47), Expect = 8.4 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 RPWLCYIKKYIYKRKTSK 85 R +LCY + Y Y RKT + Sbjct: 138 RSFLCYHQHYGYLRKTDR 155 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 588,457 Number of Sequences: 2352 Number of extensions: 10819 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -