BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_J13 (558 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 25 1.3 AY341195-1|AAR13759.1| 294|Anopheles gambiae laminin protein. 24 3.9 AY341194-1|AAR13758.1| 294|Anopheles gambiae laminin protein. 24 3.9 AY341193-1|AAR13757.1| 294|Anopheles gambiae laminin protein. 24 3.9 AY341192-1|AAR13756.1| 294|Anopheles gambiae laminin protein. 24 3.9 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 24 3.9 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 23 6.8 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 9.0 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 25.4 bits (53), Expect = 1.3 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +2 Query: 380 HPDVEKNATALREKLQAAVQNTVQEXHKLANXVXSNVXXT 499 H + E+NA + L A + TV + H L+N N T Sbjct: 316 HVEAERNARNAQHLLLRANRLTVSDNHNLSNSGSGNTAGT 355 >AY341195-1|AAR13759.1| 294|Anopheles gambiae laminin protein. Length = 294 Score = 23.8 bits (49), Expect = 3.9 Identities = 13/51 (25%), Positives = 23/51 (45%) Frame = +2 Query: 299 DANGKAXEALEQSXQNIERTAEELRKAHPDVEKNATALREKLQAAVQNTVQ 451 +A+ KA EAL+++ + A ++ + REKL + T Q Sbjct: 75 EAHKKASEALKKANDAFNQQANITKELDTSISSEIAQAREKLNTVSKLTEQ 125 >AY341194-1|AAR13758.1| 294|Anopheles gambiae laminin protein. Length = 294 Score = 23.8 bits (49), Expect = 3.9 Identities = 13/51 (25%), Positives = 23/51 (45%) Frame = +2 Query: 299 DANGKAXEALEQSXQNIERTAEELRKAHPDVEKNATALREKLQAAVQNTVQ 451 +A+ KA EAL+++ + A ++ + REKL + T Q Sbjct: 75 EAHKKASEALKKANDAFNQQANITKELDTSISSEIAQAREKLNTVSKLTEQ 125 >AY341193-1|AAR13757.1| 294|Anopheles gambiae laminin protein. Length = 294 Score = 23.8 bits (49), Expect = 3.9 Identities = 13/51 (25%), Positives = 23/51 (45%) Frame = +2 Query: 299 DANGKAXEALEQSXQNIERTAEELRKAHPDVEKNATALREKLQAAVQNTVQ 451 +A+ KA EAL+++ + A ++ + REKL + T Q Sbjct: 75 EAHKKASEALKKANDAFNQQANITKELDTSISSEIAQAREKLNTVSKLTEQ 125 >AY341192-1|AAR13756.1| 294|Anopheles gambiae laminin protein. Length = 294 Score = 23.8 bits (49), Expect = 3.9 Identities = 13/51 (25%), Positives = 23/51 (45%) Frame = +2 Query: 299 DANGKAXEALEQSXQNIERTAEELRKAHPDVEKNATALREKLQAAVQNTVQ 451 +A+ KA EAL+++ + A ++ + REKL + T Q Sbjct: 75 EAHKKASEALKKANDAFNQQANITKELDTSISSEIAQAREKLNTVSKLTEQ 125 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.8 bits (49), Expect = 3.9 Identities = 13/51 (25%), Positives = 23/51 (45%) Frame = +2 Query: 299 DANGKAXEALEQSXQNIERTAEELRKAHPDVEKNATALREKLQAAVQNTVQ 451 +A+ KA EAL+++ + A ++ + REKL + T Q Sbjct: 1214 EAHKKASEALKKANDAFNQQANITKELDTSISSEIAQAREKLNTVSKLTEQ 1264 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 23.0 bits (47), Expect = 6.8 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +3 Query: 96 DGATRRSRLLQGHRTPHQGVP*DFRTTV*LAHQVKGRTGLQQGLEGRLRVRAA 254 DG++R R Q P QGVP + + QV +T Q G +G + V + Sbjct: 1113 DGSSRTVRQFQFITWPEQGVPKSGQGFIDFIGQVH-KTKEQFGQDGPITVHCS 1164 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 22.6 bits (46), Expect = 9.0 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = +3 Query: 57 RSSLRLHRSGPRSDGAT 107 R ++R+ R+GPRS+ T Sbjct: 414 RFTIRMARAGPRSEATT 430 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 371,537 Number of Sequences: 2352 Number of extensions: 5583 Number of successful extensions: 75 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 74 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 75 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52142868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -