BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_J04 (649 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2A9.08c |sec22||SNARE Sec22|Schizosaccharomyces pombe|chr 2|... 26 4.1 SPAC144.10c |gwt1|mug59|pig-W|Schizosaccharomyces pombe|chr 1|||... 25 7.1 SPBC1604.19c |||TRAPP complex subunit Trs85 |Schizosaccharomyces... 25 7.1 SPAC6C3.06c |||P-type ATPase, calcium transporting|Schizosacchar... 25 9.4 >SPBC2A9.08c |sec22||SNARE Sec22|Schizosaccharomyces pombe|chr 2|||Manual Length = 209 Score = 26.2 bits (55), Expect = 4.1 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +2 Query: 119 NNVNALQEFQKDVNLLLTKMIGDLLHSGNN 208 +N++ L KDV ++TK I DLL+ G++ Sbjct: 126 DNLDKLNTELKDVTRVMTKNIEDLLYRGDS 155 >SPAC144.10c |gwt1|mug59|pig-W|Schizosaccharomyces pombe|chr 1|||Manual Length = 459 Score = 25.4 bits (53), Expect = 7.1 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -3 Query: 626 SHFNLLTSVFLLKFCLLQKVTYKKF 552 S+FNL T + LL CLL ++K+ Sbjct: 249 SYFNLATFITLLHHCLLVLTPFQKW 273 >SPBC1604.19c |||TRAPP complex subunit Trs85 |Schizosaccharomyces pombe|chr 2|||Manual Length = 658 Score = 25.4 bits (53), Expect = 7.1 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +2 Query: 170 TKMIGDLLHSGNNEMVEDEYCSTDDDQPPIS 262 T I L ++ + M + +CS+ DD PI+ Sbjct: 296 TSSIQSLKNAPRDSMESESFCSSSDDAKPIT 326 >SPAC6C3.06c |||P-type ATPase, calcium transporting|Schizosaccharomyces pombe|chr 1|||Manual Length = 1033 Score = 25.0 bits (52), Expect = 9.4 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -2 Query: 324 KQVMFYSKLVCTKFYFXVFLGLIGGWSSSVEQYSS 220 K++ FYSK++CT F + +GL + Y S Sbjct: 315 KEINFYSKILCT-FVLVLSIGLTFSHGIKTDWYIS 348 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,094,012 Number of Sequences: 5004 Number of extensions: 34755 Number of successful extensions: 67 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 67 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 291768710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -