BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_I23 (506 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC576.09 |rps20||40S ribosomal protein S20|Schizosaccharomyces... 170 1e-43 SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase comple... 27 1.2 SPBC649.05 |cut12|stf1|spindle pole body protein Cut12 |Schizosa... 27 1.6 SPBC211.01 |rsm10|SPBC23E6.11|mitochondrial ribosomal protein su... 27 1.6 >SPCC576.09 |rps20||40S ribosomal protein S20|Schizosaccharomyces pombe|chr 3|||Manual Length = 118 Score = 170 bits (413), Expect = 1e-43 Identities = 82/110 (74%), Positives = 96/110 (87%) Frame = +2 Query: 137 EKPQAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRK 316 +K Q S +HRIRITLTSRNVR+LEKVC+DL+N AK ++LRVKGPVR+PTKIL+ITTRK Sbjct: 8 QKEQQIPSTVHRIRITLTSRNVRNLEKVCSDLVNRAKDKQLRVKGPVRLPTKILKITTRK 67 Query: 317 TPCGEGSKTXDRFQMXIHXXVIDLHSPSEIVKQITSINIEPGVXVEVTIA 466 TP GEGSKT + ++M IH +IDLHSPSEIVKQITSI+IEPGV VEVTIA Sbjct: 68 TPNGEGSKTWETYEMRIHKRLIDLHSPSEIVKQITSIHIEPGVEVEVTIA 117 >SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase complex subunit Pst1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1522 Score = 27.5 bits (58), Expect = 1.2 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 134 IEKPQAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVK 268 IEKP+A SPIH + +R L+ V GA++ + VK Sbjct: 896 IEKPRASSSPIHH----ANNNGLRLLKDVLKKTYRGARENRSSVK 936 >SPBC649.05 |cut12|stf1|spindle pole body protein Cut12 |Schizosaccharomyces pombe|chr 2|||Manual Length = 548 Score = 27.1 bits (57), Expect = 1.6 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +2 Query: 110 AAVXSGKDIEKPQAEVSPIHRIRITLTSRNVRS 208 A V + D+EKPQ +V+ R+ L S N R+ Sbjct: 491 ANVTTSADVEKPQVKVATSSRVDYDLKSPNQRT 523 >SPBC211.01 |rsm10|SPBC23E6.11|mitochondrial ribosomal protein subunit S10|Schizosaccharomyces pombe|chr 2|||Manual Length = 224 Score = 27.1 bits (57), Expect = 1.6 Identities = 14/51 (27%), Positives = 27/51 (52%) Frame = +2 Query: 254 KLRVKGPVRMPTKILRITTRKTPCGEGSKTXDRFQMXIHXXVIDLHSPSEI 406 K+ +KGP +P K+ T ++P S + + F+ H +I L+S + + Sbjct: 92 KIPIKGPRPLPNKVESWTLLRSPFIHKS-SQENFERITHSRLIQLYSVNPV 141 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,934,164 Number of Sequences: 5004 Number of extensions: 36391 Number of successful extensions: 82 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 82 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 202220600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -