BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_I23 (506 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL132876-13|CAD21665.1| 117|Caenorhabditis elegans Hypothetical... 163 7e-41 U67947-1|AAB07557.2| 1147|Caenorhabditis elegans Hypothetical pr... 29 1.9 AF003136-7|ABE73336.1| 1539|Caenorhabditis elegans Hypothetical ... 28 4.5 Z82272-6|CAB05222.1| 1431|Caenorhabditis elegans Hypothetical pr... 27 5.9 >AL132876-13|CAD21665.1| 117|Caenorhabditis elegans Hypothetical protein Y105E8A.16 protein. Length = 117 Score = 163 bits (396), Expect = 7e-41 Identities = 74/101 (73%), Positives = 90/101 (89%) Frame = +2 Query: 167 HRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTPCGEGSKTX 346 HRIR+TLTS+NV+ LEKVCA LI+GAK + L VKGP+RMPTK+LRITTRKTPCGEGSKT Sbjct: 17 HRIRLTLTSQNVKPLEKVCAQLIDGAKNEHLIVKGPIRMPTKVLRITTRKTPCGEGSKTW 76 Query: 347 DRFQMXIHXXVIDLHSPSEIVKQITSINIEPGVXVEVTIAD 469 DRFQM IH +I+LH+P+E+++QITSI+IEPGV +EVT AD Sbjct: 77 DRFQMRIHKRLINLHAPAEVLRQITSISIEPGVDIEVTRAD 117 >U67947-1|AAB07557.2| 1147|Caenorhabditis elegans Hypothetical protein H03E18.1 protein. Length = 1147 Score = 29.1 bits (62), Expect = 1.9 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +2 Query: 209 LEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTPCGE 331 +E V A + G KK+ + K + PTK +T++ P E Sbjct: 359 VELVTAKTVEGEKKETKKPKSTTKKPTKTAAASTKRPPTTE 399 >AF003136-7|ABE73336.1| 1539|Caenorhabditis elegans Hypothetical protein F28B3.1 protein. Length = 1539 Score = 27.9 bits (59), Expect = 4.5 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +2 Query: 140 KPQAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKK 250 + +A+ SP HRI +TS+N C+ L+ A++ Sbjct: 943 RSRAQSSPDHRILTLVTSKNAEQDTATCSTLLKRAER 979 >Z82272-6|CAB05222.1| 1431|Caenorhabditis elegans Hypothetical protein F55G11.9 protein. Length = 1431 Score = 27.5 bits (58), Expect = 5.9 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 504 FQKYFIGGSAYASAMVTSTXTPGSMLIEVICFT 406 F YF+ Y +A + +T T GS+L+ V C T Sbjct: 958 FLLYFVS-LVYLTASLINTPTKGSLLLYVFCLT 989 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,922,684 Number of Sequences: 27780 Number of extensions: 219370 Number of successful extensions: 454 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 449 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 454 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 977860456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -