BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_I23 (506 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 1.8 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 22 3.2 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 4.2 DQ435331-1|ABD92646.1| 135|Apis mellifera OBP14 protein. 21 9.7 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 23.0 bits (47), Expect = 1.8 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = -2 Query: 103 VAC*IPAEINNFSIKNCSALKPEKPHVSSN 14 +AC A+ N+ N LK E H SSN Sbjct: 283 LACMFDAQTNSMICLNGQVLKRESIHNSSN 312 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 22.2 bits (45), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 253 EAACKGPSPHANQDPAYHH 309 E + G SPH +Q P+ +H Sbjct: 621 EISQDGSSPHFHQSPSQNH 639 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.8 bits (44), Expect = 4.2 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +1 Query: 235 QWSQETEAACKGPSPHANQDP 297 Q SQ+ + GP P +Q P Sbjct: 11 QQSQQPSSGAPGPQPSPHQSP 31 >DQ435331-1|ABD92646.1| 135|Apis mellifera OBP14 protein. Length = 135 Score = 20.6 bits (41), Expect = 9.7 Identities = 5/17 (29%), Positives = 11/17 (64%) Frame = -2 Query: 64 IKNCSALKPEKPHVSSN 14 + +CS + E PH+ ++ Sbjct: 101 VSDCSTISEENPHLKAS 117 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,537 Number of Sequences: 438 Number of extensions: 2720 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13986774 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -