BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_I21 (442 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U53148-5|AAB37076.1| 130|Caenorhabditis elegans Ribosomal prote... 85 3e-17 Z81043-4|CAB02798.1| 179|Caenorhabditis elegans Hypothetical pr... 28 3.5 Z48045-11|CAM33500.1| 887|Caenorhabditis elegans Hypothetical p... 27 6.0 Z48045-10|CAA88101.2| 849|Caenorhabditis elegans Hypothetical p... 27 6.0 AL110479-13|CAB60318.1| 204|Caenorhabditis elegans Hypothetical... 27 8.0 >U53148-5|AAB37076.1| 130|Caenorhabditis elegans Ribosomal protein, small subunitprotein 30 protein. Length = 130 Score = 84.6 bits (200), Expect = 3e-17 Identities = 40/63 (63%), Positives = 46/63 (73%) Frame = +3 Query: 243 LLGGKVHGSLARAGKVKGQTPKVEXXXXXXXXTGRAKRXIQYNRRFVNVVQTFGRRRGPN 422 LLGGKVHGSLARAGKV+ QTPKV+ GRA R +QY RR+VNV G++RGPN Sbjct: 68 LLGGKVHGSLARAGKVRAQTPKVDKQDKKKKKRGRAFRRVQYTRRYVNVASGPGKKRGPN 127 Query: 423 SNS 431 SNS Sbjct: 128 SNS 130 >Z81043-4|CAB02798.1| 179|Caenorhabditis elegans Hypothetical protein C29F3.5 protein. Length = 179 Score = 27.9 bits (59), Expect = 3.5 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -1 Query: 340 VFFXFFCCFSTLGVCPLTLPARAKDPCTLP 251 + F FFC FS G P+T P ++P +P Sbjct: 6 IIFAFFCMFSVEGCIPMTPP---EEPVVVP 32 >Z48045-11|CAM33500.1| 887|Caenorhabditis elegans Hypothetical protein C41C4.5b protein. Length = 887 Score = 27.1 bits (57), Expect = 6.0 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 Query: 341 WPC*AXNSVQQKICQRCAD 397 WPC +S ++K+C C D Sbjct: 269 WPCFPYSSWKEKLCSECVD 287 >Z48045-10|CAA88101.2| 849|Caenorhabditis elegans Hypothetical protein C41C4.5a protein. Length = 849 Score = 27.1 bits (57), Expect = 6.0 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 Query: 341 WPC*AXNSVQQKICQRCAD 397 WPC +S ++K+C C D Sbjct: 231 WPCFPYSSWKEKLCSECVD 249 >AL110479-13|CAB60318.1| 204|Caenorhabditis elegans Hypothetical protein Y105C5B.14 protein. Length = 204 Score = 26.6 bits (56), Expect = 8.0 Identities = 21/61 (34%), Positives = 29/61 (47%) Frame = +2 Query: 2 AFTCQAWLIRFYNYAVAYQRAIDTRPGRQWPGVHWSDQGTHSYSCCSWR*RPYSIIMWSP 181 A TC+ W+I +N V + RA+D R G+ S+Q T Y P +WSP Sbjct: 111 AGTCENWIIEDWNEKVVF-RAVDPR-GKYLRACLGSNQLTLVYI-------PEPTELWSP 161 Query: 182 F 184 F Sbjct: 162 F 162 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,290,415 Number of Sequences: 27780 Number of extensions: 161725 Number of successful extensions: 373 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 361 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 373 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 756625558 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -