BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_I19 (387 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016427-2|AAB65352.1| 54|Caenorhabditis elegans Hypothetical ... 54 3e-08 L23647-8|AAK29993.1| 54|Caenorhabditis elegans Hypothetical pr... 45 2e-05 L07144-2|AAK21439.1| 54|Caenorhabditis elegans Hypothetical pr... 45 2e-05 U41011-5|AAA82288.2| 320|Caenorhabditis elegans Fatty acid elon... 26 8.1 >AF016427-2|AAB65352.1| 54|Caenorhabditis elegans Hypothetical protein F32D1.2 protein. Length = 54 Score = 54.4 bits (125), Expect = 3e-08 Identities = 23/51 (45%), Positives = 33/51 (64%) Frame = +1 Query: 79 MSAWRQAGLTYINYSNIAAXVLRRSLKQEFRAXALKRDESHVRVTPWANGR 231 M AWR AGL Y+ YS IAA + R+ KQ A+K+ E+ +++T W NG+ Sbjct: 1 MVAWRAAGLNYVRYSQIAAEITRKCTKQVGGKAAVKKPEATLKITTWENGK 51 >L23647-8|AAK29993.1| 54|Caenorhabditis elegans Hypothetical protein ZC262.5 protein. Length = 54 Score = 44.8 bits (101), Expect = 2e-05 Identities = 21/51 (41%), Positives = 31/51 (60%) Frame = +1 Query: 79 MSAWRQAGLTYINYSNIAAXVLRRSLKQEFRAXALKRDESHVRVTPWANGR 231 M AWR AGL Y+ YS IAA V+R+ K +K+ ++ ++ T W NG+ Sbjct: 1 MVAWRAAGLNYVRYSQIAAQVVRQCTK---GGANVKKPQATLKTTAWENGK 48 >L07144-2|AAK21439.1| 54|Caenorhabditis elegans Hypothetical protein R05D3.6 protein. Length = 54 Score = 44.8 bits (101), Expect = 2e-05 Identities = 21/51 (41%), Positives = 31/51 (60%) Frame = +1 Query: 79 MSAWRQAGLTYINYSNIAAXVLRRSLKQEFRAXALKRDESHVRVTPWANGR 231 M AWR AGL Y+ YS IAA V+R+ K +K+ ++ ++ T W NG+ Sbjct: 1 MVAWRAAGLNYVRYSQIAAQVVRQCTK---GGANVKKPQATLKTTAWENGK 48 >U41011-5|AAA82288.2| 320|Caenorhabditis elegans Fatty acid elongation protein 3 protein. Length = 320 Score = 26.2 bits (55), Expect = 8.1 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = -1 Query: 339 SVIYCTIVH--KLIVDDFHACWLTIPXSLWNSFLEV 238 SV+Y ++ K I++ + L P +WNSFL + Sbjct: 45 SVVYVAVIFTGKKIMEKYKPFQLDTPLFVWNSFLAI 80 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,651,797 Number of Sequences: 27780 Number of extensions: 133160 Number of successful extensions: 260 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 260 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 260 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 576961812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -