BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_I19 (387 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein ... 22 2.8 AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein ... 22 2.8 >DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein 1 protein. Length = 116 Score = 21.8 bits (44), Expect = 2.8 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -1 Query: 327 CTIVHKLIVDDFHACWLTIPXSLWNSFLEV 238 CT + K +D + T WN F+E+ Sbjct: 78 CTEIQKQNLDKLAEWFTTNEPEKWNHFVEI 107 >AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein protein. Length = 116 Score = 21.8 bits (44), Expect = 2.8 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -1 Query: 327 CTIVHKLIVDDFHACWLTIPXSLWNSFLEV 238 CT + K +D + T WN F+E+ Sbjct: 78 CTEIQKQNLDKLAEWFTTNEPEKWNHFVEI 107 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,538 Number of Sequences: 438 Number of extensions: 1363 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9391092 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -