BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_I11 (648 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_02_0185 + 12774608-12775970,12776058-12776983 30 1.8 11_06_0655 - 25923171-25923185,25923208-25923432,25923865-259243... 27 9.7 >06_02_0185 + 12774608-12775970,12776058-12776983 Length = 762 Score = 29.9 bits (64), Expect = 1.8 Identities = 19/60 (31%), Positives = 29/60 (48%) Frame = +1 Query: 79 TTLLSLRIAFLLPVFRTTNXEYGNGASCLSAHGFDMPHAIVGIYSGAKNIFIXRNXTSDG 258 T + S + F + +FRT + G G + + A G D P G YSG + N ++DG Sbjct: 114 TYVASFNMVFRVNIFRTNTSDPGEGVAFVVASGLDPPPP--GSYSGFLGL---TNASTDG 168 >11_06_0655 - 25923171-25923185,25923208-25923432,25923865-25924324, 25924330-25924985 Length = 451 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/52 (25%), Positives = 22/52 (42%) Frame = -2 Query: 494 PQGMNICISXLYFSLAARIFRXQKT*TAYNCSNYTIRFH*ES*RLYPWRRRI 339 P+ + C+S YF + F K Y C + ++ + + PWR I Sbjct: 292 PRNWSWCLSRAYFGVVGLSFVSSKLEVLYGCFDRSLEYTASPPPVPPWRAAI 343 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,198,359 Number of Sequences: 37544 Number of extensions: 294259 Number of successful extensions: 527 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 522 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 527 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1608522592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -