BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_I11 (648 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 22 5.9 AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc fi... 21 7.8 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 7.8 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 21.8 bits (44), Expect = 5.9 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +1 Query: 25 CARYETTVRRTRSCDVD 75 C +ETT CDVD Sbjct: 47 CGIHETTYNSIMKCDVD 63 >AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc finger domain-Z3 isoform protein. Length = 92 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -3 Query: 175 HEQKDSLLHCHIXSS*YETQEA 110 HEQ D+L C + Y T+ + Sbjct: 29 HEQSDTLYVCEFCNRRYRTKNS 50 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.4 bits (43), Expect = 7.8 Identities = 9/30 (30%), Positives = 12/30 (40%) Frame = +1 Query: 34 YETTVRRTRSCDVDWTTLLSLRIAFLLPVF 123 YE +R C DW ++ PVF Sbjct: 373 YENEMRLRNGCPADWLWIVPPISGSATPVF 402 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,848 Number of Sequences: 438 Number of extensions: 3645 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19560480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -