BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_I10 (650 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_03_0150 - 15750329-15750450,15751554-15751644,15751967-157520... 77 2e-14 04_03_0268 - 13663387-13663505,13663935-13664025,13664788-136648... 50 1e-06 04_04_0491 - 25605560-25605684,25605826-25605928,25606026-256075... 31 1.1 03_05_0187 - 21751374-21752631,21752958-21753399,21753914-21753962 30 1.4 02_02_0522 - 11161385-11161537,11162513-11162668,11164176-111642... 28 7.4 >02_03_0150 - 15750329-15750450,15751554-15751644,15751967-15752053, 15752605-15752660,15752812-15752893,15753141-15753217, 15754028-15754138,15754744-15754906,15755375-15755433, 15755882-15756011 Length = 325 Score = 76.6 bits (180), Expect = 2e-14 Identities = 31/64 (48%), Positives = 42/64 (65%) Frame = +2 Query: 374 DIXQRIVWMDLEMTGLDIENDHIMEIACLVTDAQLNVVATGPDIXINLPEVTLNKMNNWC 553 D +VW+DLEMTGLD+ D I+EIAC++TD +L GPD+ IN + L+ M+ WC Sbjct: 141 DYQMPLVWIDLEMTGLDVAKDRILEIACIITDGKLTKQIEGPDLVINQKKDLLDNMDEWC 200 Query: 554 KVQH 565 K H Sbjct: 201 KTHH 204 >04_03_0268 - 13663387-13663505,13663935-13664025,13664788-13664874, 13665849-13665904,13666788-13666841,13667413-13667523, 13668293-13668419 Length = 214 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/32 (62%), Positives = 26/32 (81%) Frame = +2 Query: 374 DIXQRIVWMDLEMTGLDIENDHIMEIACLVTD 469 D + +VW+DLEMTGLDI D I+EIAC++TD Sbjct: 66 DYDKPLVWIDLEMTGLDITKDRILEIACIITD 97 >04_04_0491 - 25605560-25605684,25605826-25605928,25606026-25607592, 25608694-25610198 Length = 1099 Score = 30.7 bits (66), Expect = 1.1 Identities = 19/52 (36%), Positives = 31/52 (59%) Frame = -1 Query: 536 CLKSLQVDL*XYRDLSPLHLAVHLSQDTLFPLCGHFQCQVLSFQDPSIQSSE 381 C K L V L + +SP H ++ L ++ + + G C+VL FQ+PS+Q S+ Sbjct: 978 CHKKL-VSLRKLQHISPFH-SLRLRKELVQKVSG---CEVLPFQNPSVQDSQ 1024 >03_05_0187 - 21751374-21752631,21752958-21753399,21753914-21753962 Length = 582 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = -3 Query: 540 ILFKVTSGRFIXISGPVATTFSCASVTRHAISIMWSFSMSSP 415 +L V SG F +S VAT C TRHA + + +S +P Sbjct: 257 VLSSVLSGFFQEVSSLVATGSPCTDTTRHAHLLDFLYSNMAP 298 >02_02_0522 - 11161385-11161537,11162513-11162668,11164176-11164298, 11164404-11164466,11164512-11164577,11165128-11165232, 11165336-11165435,11165520-11165590,11166037-11166093, 11167215-11167292,11167367-11167441,11168490-11168540, 11169015-11169094,11169560-11169660,11169749-11169810, 11170084-11170590 Length = 615 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +1 Query: 268 YIQHDKIYVITKCNNVLNS*FVHVSENNDEK 360 +++H + YV+TK N L + + E ND K Sbjct: 444 FVKHSRSYVLTKPKNALGRQYTKLFEMNDVK 474 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,845,516 Number of Sequences: 37544 Number of extensions: 248614 Number of successful extensions: 472 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 465 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 472 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -