BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_I10 (650 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 25 0.84 DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate r... 22 4.5 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 22 4.5 AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-tripho... 22 4.5 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 5.9 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 5.9 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 21 7.8 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 21 7.8 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 21 7.8 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 24.6 bits (51), Expect = 0.84 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +2 Query: 338 SPKIMMKKNTKVDIXQRIVWMDLEMTGLDIENDHI 442 S K+M+ + T DI R + M LE ++ EN+ + Sbjct: 19 SSKVMLTRGTVNDIVSRNITMVLENLLMNYENNQL 53 >DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate receptor protein. Length = 322 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = -2 Query: 412 HFKIHPYNPLXYVNFSIFFHHYFRR 338 H +H Y PL + F H+ +R Sbjct: 133 HLAMHDYPPLVSGALHLLFRHFSQR 157 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -3 Query: 189 CTTLHYIHTISEIY 148 C TLH+ H EIY Sbjct: 467 CNTLHHWHHCPEIY 480 >AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-triphosphate recepter protein. Length = 178 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = -2 Query: 412 HFKIHPYNPLXYVNFSIFFHHYFRR 338 H +H Y PL + F H+ +R Sbjct: 101 HLAMHDYPPLVSGALHLLFRHFSQR 125 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -3 Query: 42 SNLDMCVKELXDRS 1 SNLDM V E DRS Sbjct: 44 SNLDMSVLECADRS 57 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -3 Query: 42 SNLDMCVKELXDRS 1 SNLDM V E DRS Sbjct: 134 SNLDMSVLECADRS 147 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 391 NPLXYVNFSIFFHHYFRR 338 NPL Y F++ + FRR Sbjct: 377 NPLIYTIFNLDYRRAFRR 394 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 391 NPLXYVNFSIFFHHYFRR 338 NPL Y F++ + FRR Sbjct: 377 NPLIYTIFNLDYRRAFRR 394 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 391 NPLXYVNFSIFFHHYFRR 338 NPL Y F++ + FRR Sbjct: 377 NPLIYTIFNLDYRRAFRR 394 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,871 Number of Sequences: 438 Number of extensions: 3702 Number of successful extensions: 11 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -